You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TXK
Tyrosine-protein kinase TXK

Protein Summary
Description
Non-receptor tyrosine kinase that plays a redundant role with ITK in regulation of the adaptive immune response. Regulates the development, function and differentiation of conventional T-cells and nonconventional NKT-cells. When antigen presenting cells (APC) activate T-cell receptor (TCR), a series of phosphorylation lead to the recruitment of TXK to the cell membrane, where it is phosphorylated at Tyr-420. Phosphorylation leads to TXK full activation. Contributes also to signaling from many receptors and participates in multiple downstream pathways, including regulation of the actin cytoskeleton. Like ITK, can phosphorylate PLCG1, leading to its localization in lipid rafts and activation, followed by subsequent cleavage of its substrates. In turn, the endoplasmic reticulum releases calcium in the cytoplasm and the nuclear activator of activated T-cells (NFAT) translocates into the nucleus to perform its transcriptional duty. With PARP1 and EEF1A1, TXK forms a complex that acts as a T ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264316
  • ENSP00000264316
  • ENSG00000074966

Symbol
  • PTK4
  • RLK
  • RLK
  • TKL
  • BTKL
  • PTK4
  • PSCTK5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
protein domain
0.97
biological process
0.95
tissue sample
0.66
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 217.93   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 244   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 217.93   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 244   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 9
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
FCERI mediated Ca+2 mobilization (R-HSA-2871809)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
FCERI mediated Ca+2 mobilization
Reactome
Fc epsilon receptor (FCERI) signaling
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
FCERI mediated Ca+2 mobilization
Fc epsilon receptor (FCERI) signaling
Immune System
Innate Immune System
Gene Ontology Terms (19)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (77)
1 – 10 of 77
LCP2
Tbio
Novelty: 0.00631737
Score: 0.984
Data Source: STRINGDB
GRAP2
Tbio
Novelty: 0.00186531
Score: 0.942
Data Source: STRINGDB
VAV1
Tchem
Novelty: 0.00223848
Score: 0.934
Data Source: STRINGDB
PLCG1
Tchem
Family: Enzyme
Novelty: 0.00125418
Score: 0.93
Data Source: STRINGDB
PLCG2
Tchem
Family: Enzyme
Novelty: 0.00370802
Score: 0.922
Data Source: STRINGDB
ITK
Tclin
Family: Kinase
Novelty: 0.00113895
Score: 0.922
Data Source: STRINGDB
VAV2
Tbio
Novelty: 0.01424769
Score: 0.919
Data Source: STRINGDB
SYK
Tclin
Family: Kinase
Novelty: 0.00067612
Score: 0.919
Data Source: STRINGDB
VAV3
Tbio
Novelty: 0.01366247
Score: 0.917
Data Source: STRINGDB
IGLL5
Tbio
Novelty: 0.00642197
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  217.93

PubMed score by year
PubTator Score  374.97

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSNTGRVQPSKRK
1-70
PLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWWKARDRLGNEGLIPSNYVTEN
70-140
KITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDS
140-210
GQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSG
210-280
QFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGC
280-350
LLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
350-420
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHL
420-490
APMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
490-527
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSNTGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWWKARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW