You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MLLT3
Protein AF-9

Protein Summary
Description
Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA (PubMed:20159561, PubMed:20471948, PubMed:25417107, PubMed:27105114, PubMed:27545619). Specifically recognizes and binds acylated histone H3, with a marked preference for histone H3 that is crotonylated (PubMed:25417107, PubMed:27105114, PubMed:27545619). Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors (PubMed:25417107, PubMed:27105114, PubMed:27545619). Recognizes and binds histone H3 crotonylated at 'Lys-9' (H3K9cr), and with slightly lower affinity histone H3 crotonylated at 'Lys-18' (H3K18cr) (PubMed:27105114). Also recognizes and binds histone H3 acetylated at 'Lys-9' (H3K9ac), but with lower affinity than crotonylated histone H3 (PubMed:25417107, PubMed:27105114). In the SEC complex, MLLT3 is re ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380338
  • ENSP00000369695
  • ENSG00000171843
  • ENST00000630269
  • ENSP00000485996

Symbol
  • AF9
  • YEATS3
  • AF9
  • YEATS3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
PubMedID
0.93
virus perturbation
0.85
transcription factor binding site profile
0.79
histone modification site profile
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 210.35   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 261   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 210.35   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 261   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Formation of RNA Pol II elongation complex (R-HSA-112382)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Formation of RNA Pol II elongation complex
Reactome
Gene expression (Transcription)
Reactome
RNA Polymerase II Pre-transcription Events
Reactome
RNA Polymerase II Transcription
Reactome
RNA Polymerase II Transcription Elongation
Name
Explore in Pharos
Explore in Source
Formation of RNA Pol II elongation complex
Gene expression (Transcription)
RNA Polymerase II Pre-transcription Events
RNA Polymerase II Transcription
RNA Polymerase II Transcription Elongation
Gene Ontology Terms (17)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence Model (ISM)
NTNU_SB
Protein-Protein Interactions (233)
1 – 10 of 233
PIP4K2A
Tbio
Family: Kinase
Novelty: 0.01482796
p_int: 0.999999679
p_ni: 3.21e-7
Score: 0.184
Data Source: BioPlex,STRINGDB
EPB41L1
Tbio
Novelty: 0.01521218
p_int: 0.999999353
p_ni: 6.47e-7
Data Source: BioPlex
EPB41L3
Tbio
Novelty: 0.00828944
p_int: 0.999996778
p_ni: 0.000003222
Data Source: BioPlex
EPB41L2
Tbio
Novelty: 0.03894804
p_int: 0.999996319
p_ni: 0.000003681
Data Source: BioPlex
CAMKV
Tbio
Family: Kinase
Novelty: 0.02297481
p_int: 0.999995742
p_ni: 0.000004258
Data Source: BioPlex
ELL3
Tbio
Family: Enzyme
Novelty: 0.23904382
p_int: 0.999984043
p_ni: 0.000015957
Score: 0.812
Data Source: BioPlex,STRINGDB
MLLT6
Tdark
Family: Epigenetic
Novelty: 0.04069948
p_int: 0.999836249
p_ni: 0.000163751
Score: 0.86
Data Source: BioPlex,STRINGDB
SNX24
Tdark
Novelty: 2.47058824
p_int: 0.999342684
p_ni: 0.000657306
p_wrong: 1e-8
Data Source: BioPlex
BPIFB1
Tbio
Novelty: 0.05488828
p_int: 0.999230328
p_ni: 0.000769669
p_wrong: 3e-9
Score: 0.183
Data Source: BioPlex,STRINGDB
MDK
Tchem
Novelty: 0.00179902
p_int: 0.999063395
p_ni: 0.000936605
Data Source: BioPlex
Publication Statistics
PubMed Score  210.35

PubMed score by year
PubTator Score  113.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPP
1-70
YKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGG
70-140
DPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKD
140-210
SREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKA
210-280
PSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKS
280-350
TLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD
350-420
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKS
420-490
DKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQS
490-560
YLETSGTS
560-568
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS