You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
GRIA1
Glutamate receptor 1

Protein Summary
Description
Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate. Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate re ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000285900
  • ENSP00000285900
  • ENSG00000155511
  • ENST00000340592
  • ENSP00000339343
  • ENST00000448073
  • ENSP00000415569
  • ENST00000518142
  • ENSP00000427920
  • ENST00000518783
  • ENSP00000428994
  • ENST00000521843
  • ENSP00000427864

Symbol
  • GLUH1
  • GLUR1
  • GLUH1
  • GLUR1
  • GLURA
  • GluA1
  • HBGR1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
hub protein
0.88
biological term
0.81
kinase
0.8
trait
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1513.92   (req: < 5)
Gene RIFs: 55   (req: <= 3)
Antibodies: 932   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1513.92   (req: >= 5)
Gene RIFs: 55   (req: > 3)
Antibodies: 932   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 68
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 6
Pathways (103)
Activation of AMPA receptors (R-HSA-399710)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 22
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of AMPA receptors
Reactome
Activation of NMDA receptors and postsynaptic events
Reactome
Asparagine N-linked glycosylation
Reactome
COPII-mediated vesicle transport
Reactome
Cargo concentration in the ER
Name
Explore in Pharos
Explore in Source
Activation of AMPA receptors
Activation of NMDA receptors and postsynaptic events
Asparagine N-linked glycosylation
COPII-mediated vesicle transport
Cargo concentration in the ER
Gene Ontology Terms (36)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
ARUK-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (366)
1 – 10 of 366
DLG1
Tbio
Novelty: 0.00644048
Score: 0.997
Data Source: STRINGDB
DLG4
Tchem
Novelty: 0.00079421
Score: 0.993
Data Source: STRINGDB
CACNG2
Tbio
Family: IC
Novelty: 0.01171137
Score: 0.992
Data Source: STRINGDB
PICK1
Tbio
Novelty: 0.00686801
Score: 0.981
Data Source: Reactome,STRINGDB
PRKCA
Tchem
Family: Kinase
Novelty: 0.00099987
Score: 0.981
Data Source: STRINGDB
CNIH2
Tbio
Novelty: 0.11088352
Score: 0.981
Data Source: Reactome,STRINGDB
EPB41L1
Tbio
Novelty: 0.01521218
Score: 0.978
Data Source: STRINGDB
GRIP1
Tbio
Novelty: 0.00647926
Score: 0.976
Data Source: Reactome,STRINGDB
CAMK2A
Tchem
Family: Kinase
Novelty: 0.01196206
Score: 0.97
Data Source: Reactome,STRINGDB
GRIA2
Tclin
Family: IC
Novelty: 0.00187801
Score: 0.967
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  1513.92

PubMed score by year
PubTator Score  599.08

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEM
1-70
TYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHY
70-140
KWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLN
140-210
AILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTR
210-280
VDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLT
280-350
GNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
350-420
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAV
420-490
APLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF
490-560
SPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSY
560-630
TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTT
630-700
EEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQ
700-770
GLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
770-840
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
840-906
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL