You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
VIPR2
Vasoactive intestinal polypeptide receptor 2

Protein Summary
Description
This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C. This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262178
  • ENSP00000262178
  • ENSG00000106018
  • ENST00000377633
  • ENSP00000366860

Symbol
  • VIP2R
  • VPAC2
  • VPAC2R
  • VIP-R-2
  • VPCAP2R
  • PACAP-R3
  • DUP7q36.3
  • PACAP-R-3
  • C16DUPq36.3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
gene perturbation
0.78
ligand (protein)
0.68
disease perturbation
0.62
ligand (chemical)
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 149.14   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 307   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 149.14   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 307   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 6
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Class B/2 (Secretin family receptors) (R-HSA-373080)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class B/2 (Secretin family receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Glucagon-type ligand receptors
Name
Explore in Pharos
Explore in Source
Class B/2 (Secretin family receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Glucagon-type ligand receptors
Gene Ontology Terms (12)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (246)
1 – 10 of 246
SNX17
Tbio
Novelty: 0.05959005
p_int: 0.999998845
p_ni: 0.000001155
Data Source: BioPlex
RABGAP1
Tbio
Family: Enzyme
Novelty: 0.17171575
p_int: 0.999998734
p_ni: 0.000001266
Data Source: BioPlex
VPS8
Tbio
Novelty: 0.07454519
p_int: 0.999992863
p_ni: 0.000007137
Data Source: BioPlex
PLIN3
Tbio
Novelty: 0.01218096
p_int: 0.99998339
p_ni: 0.00001661
Data Source: BioPlex
VEZT
Tbio
Novelty: 0.07933548
p_int: 0.999970869
p_ni: 0.000029131
Data Source: BioPlex
CERS5
Tbio
Family: TF
Novelty: 0.04558376
p_int: 0.999916106
p_ni: 0.000083873
p_wrong: 2.1e-8
Data Source: BioPlex
RABGAP1L
Tbio
Family: Enzyme
Novelty: 0.369696
p_int: 0.999874422
p_ni: 0.000125578
Data Source: BioPlex
SLC35F1
Tdark
Family: Transporter
Novelty: 0.71189535
p_int: 0.999829847
p_ni: 0.000133417
p_wrong: 0.000036735
Data Source: BioPlex
CDS1
Tbio
Family: Enzyme
Novelty: 0.06388642
p_int: 0.999794739
p_ni: 0.000203177
p_wrong: 0.000002083
Data Source: BioPlex
PDS5B
Tbio
Novelty: 0.00263816
p_int: 0.999793027
p_ni: 0.000206973
Data Source: BioPlex
Publication Statistics
PubMed Score  149.14

PubMed score by year
PubTator Score  95.52

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGET
1-70
VTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMS
70-140
LATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQ
140-210
YCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVP
210-280
WWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIS
280-350
ISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ
350-420
FHRGSRAQSFLQTETSVI
420-438
MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI