You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ADCYAP1R1
Pituitary adenylate cyclase-activating polypeptide type I receptor

Protein Summary
Description
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract. This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000304166
  • ENSP00000306620
  • ENSG00000078549
  • ENST00000396211
  • ENSP00000379514
  • ENST00000409363
  • ENSP00000387335
  • ENST00000614107
  • ENSP00000483721

Symbol
  • PAC1
  • PAC1R
  • PACAPR
  • PACAPRI
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.87
protein domain
0.73
microRNA
0.7
ligand (protein)
0.68
PubMedID
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 105.7   (req: < 5)
Gene RIFs: 52   (req: <= 3)
Antibodies: 269   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 105.7   (req: >= 5)
Gene RIFs: 52   (req: > 3)
Antibodies: 269   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 6
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (68)
Activation of TRKA receptors (R-HSA-187015)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of TRKA receptors
Reactome
Class B/2 (Secretin family receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Activation of TRKA receptors
Class B/2 (Secretin family receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (32)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (151)
1 – 10 of 151
ADCYAP1
Tbio
Family: Enzyme
Novelty: 0.0008626
Score: 0.998
Data Source: Reactome,STRINGDB
VIP
Tbio
Novelty: 0.00028207
Score: 0.979
Data Source: STRINGDB
SCT
Tbio
Novelty: 0.00076973
Score: 0.964
Data Source: STRINGDB
CRH
Tbio
Novelty: 0.00017805
Score: 0.955
Data Source: STRINGDB
ADCY1
Tchem
Family: Enzyme
Novelty: 0.01107447
Score: 0.95
Data Source: STRINGDB
RAMP1
Tclin
Novelty: 0.01081211
Score: 0.948
Data Source: STRINGDB
NTRK2
Tclin
Family: Kinase
Novelty: 0.00060827
Score: 0.947
Data Source: Reactome,STRINGDB
GCG
Tchem
Novelty: 0.00005614
Score: 0.945
Data Source: STRINGDB
ADCY8
Tbio
Family: Enzyme
Novelty: 0.00570107
Score: 0.943
Data Source: STRINGDB
GHRH
Tbio
Novelty: 0.00041525
Score: 0.942
Data Source: STRINGDB
Publication Statistics
PubMed Score  105.70

PubMed score by year
PubTator Score  173.62

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVG
1-70
EMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE
70-140
SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWIL
140-210
YAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVC
210-280
VTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLR
280-350
LARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKV
350-420
NRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT
420-468
MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT