You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC19A1
Folate transporter 1

Protein Summary
Description
Transporter for the intake of folate. Uptake of folate in human placental choriocarcinoma cells occurs by a novel mechanism called potocytosis which functionally couples three components, namely the folate receptor, the folate transporter, and a V-type H(+)-pump. The membrane protein encoded by this gene is a transporter of folate and is involved in the regulation of intracellular concentrations of folate. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000311124
  • ENSP00000308895
  • ENSG00000173638
  • ENST00000380010
  • ENSP00000369347
  • ENST00000485649
  • ENSP00000441772

Symbol
  • FLOT1
  • RFC1
  • RFC
  • CHMD
  • FOLT
  • IFC1
  • REFC
  • RFC1
  • IFC-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.97
disease perturbation
0.87
biological term
0.82
virus perturbation
0.76
disease
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 145.16   (req: < 5)
Gene RIFs: 150   (req: <= 3)
Antibodies: 110   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 145.16   (req: >= 5)
Gene RIFs: 150   (req: > 3)
Antibodies: 110   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 10
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Active Ligands (10)
1 – 10 of 10
CHEMBL1834488
chemical structure image
CHEMBL3628344
chemical structure image
CHEMBL3628346
chemical structure image
CHEMBL390990
chemical structure image
CHEMBL3628345
chemical structure image
CHEMBL3409335
chemical structure image
CHEMBL3407519
chemical structure image
CHEMBL3409334
chemical structure image
CHEMBL3409336
chemical structure image
CHEMBL388501
chemical structure image
Pathways (16)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of folate and pterines
Reactome
Metabolism of vitamins and cofactors
Reactome
Metabolism of water-soluble vitamins and cofactors
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of folate and pterines
Metabolism of vitamins and cofactors
Metabolism of water-soluble vitamins and cofactors
Protein-Protein Interactions (72)
1 – 10 of 72
TNFRSF10C
Tbio
Novelty: 0.00061543
p_int: 0.999998016
p_ni: 3.31e-7
p_wrong: 0.000001652
Data Source: BioPlex
CD164L2
Tdark
Novelty: 0.72815534
p_int: 0.998620745
p_ni: 0.000001641
p_wrong: 0.001377613
Score: 0.689
Data Source: BioPlex,STRINGDB
GGH
Tchem
Family: Enzyme
Novelty: 0.00341456
Score: 0.902
Data Source: STRINGDB
TPMT
Tchem
Family: Enzyme
Novelty: 0.00518972
Score: 0.901
Data Source: STRINGDB
SLC46A1
Tchem
Family: Transporter
Novelty: 0.00568272
Score: 0.794
Data Source: STRINGDB
MTHFR
Tbio
Family: Enzyme
Novelty: 0.00020963
Score: 0.791
Data Source: STRINGDB
FOLR1
Tchem
Novelty: 0.00421214
Score: 0.768
Data Source: STRINGDB
FPGS
Tchem
Family: Enzyme
Novelty: 0.01259807
Score: 0.744
Data Source: STRINGDB
MTRR
Tbio
Family: Enzyme
Novelty: 0.00281033
Score: 0.735
Data Source: STRINGDB
MTHFD1
Tbio
Family: Enzyme
Novelty: 0.00963399
Score: 0.731
Data Source: STRINGDB
Publication Statistics
PubMed Score  145.16

PubMed score by year
PubTator Score  169.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITP
1-70
VLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYI
70-140
FSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRVSFSTLNYISLAFLTFSVVLALFLKRPKRSL
140-210
FFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAG
210-280
YYLVVYYVHILWNEVDPTTNSARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLV
280-350
FLLAHTRHPSSIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD
350-420
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKG
420-490
LGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAAD
490-560
ETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
560-591
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRVSFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTNSARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRHPSSIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSDVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ