You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CSK
Tyrosine-protein kinase CSK

Protein Summary
Description
Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN, CSK or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK. The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its associati ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000220003
  • ENSP00000220003
  • ENSG00000103653
  • ENST00000439220
  • ENSP00000414764
  • ENST00000567571
  • ENSP00000454906
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
disease perturbation
0.98
hub protein
0.98
molecular function
0.98
interacting protein
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 357.15   (req: < 5)
Gene RIFs: 109   (req: <= 3)
Antibodies: 691   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 357.15   (req: >= 5)
Gene RIFs: 109   (req: > 3)
Antibodies: 691   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Approved Drugs (2)
1 – 2 of 2
dasatinib
chemical structure image
ibrutinib
chemical structure image
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (54)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 31
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
Gene Ontology Terms (35)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (270)
1 – 10 of 270
MATK
Tbio
Family: Kinase
Novelty: 0.00103714
p_int: 0.999999942
p_wrong: 5.8e-8
Score: 0.687
Data Source: BioPlex,STRINGDB
FRK
Tchem
Family: Kinase
Novelty: 0.01371938
p_int: 0.999995858
p_ni: 0.000001175
p_wrong: 0.000002967
Score: 0.821
Data Source: BioPlex,STRINGDB
PAG1
Tbio
Novelty: 0.0206299
p_int: 0.997275623
p_ni: 0.002724376
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
PTPN22
Tchem
Family: Enzyme
Novelty: 0.0018748
Score: 0.994
Data Source: Reactome,STRINGDB
PXN
Tbio
Novelty: 0.00103853
Score: 0.978
Data Source: Reactome,STRINGDB
EGFR
Tclin
Family: Kinase
Novelty: 0.0000974
Score: 0.978
Data Source: STRINGDB
DOK1
Tbio
Novelty: 0.02119931
Score: 0.975
Data Source: STRINGDB
SHC1
Tchem
Novelty: 0.00113167
Score: 0.962
Data Source: Reactome,STRINGDB
BCAR1
Tbio
Novelty: 0.00402253
Score: 0.957
Data Source: STRINGDB
FN1
Tchem
Novelty: 0.0000437
Score: 0.957
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  357.15

PubMed score by year
PubTator Score  360.64

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG
1-70
VKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSI
70-140
DEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM
140-210
LGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRS
210-280
RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPV
280-350
KWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
350-420
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
420-450
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELHL