You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HNF4A
Hepatocyte nuclear factor 4-alpha

Protein Summary
Description
Transcriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine. The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316099
  • ENSP00000312987
  • ENSG00000101076
  • ENST00000316673
  • ENSP00000315180
  • ENST00000415691
  • ENSP00000412111
  • ENST00000443598
  • ENSP00000410911
  • ENST00000457232
  • ENSP00000396216
  • ENST00000609795
  • ENSP00000476609

Symbol
  • HNF4
  • NR2A1
  • TCF14
  • TCF
  • HNF4
  • MODY
  • FRTS4
  • MODY1
  • NR2A1
  • TCF14
  • HNF4a7
  • HNF4a8
  • HNF4a9
  • NR2A21
  • HNF4alpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
molecular function
1
microRNA
0.96
biological process
0.92
hub protein
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1435.41   (req: < 5)
Gene RIFs: 346   (req: <= 3)
Antibodies: 869   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1435.41   (req: >= 5)
Gene RIFs: 346   (req: > 3)
Antibodies: 869   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 39
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL3719130
chemical structure image
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (32)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Nuclear Receptor transcription pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Developmental Biology
Gene expression (Transcription)
Generic Transcription Pathway
Nuclear Receptor transcription pathway
RNA Polymerase II Transcription
Gene Ontology Terms (42)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (315)
1 – 10 of 315
TP53
Tchem
Family: TF
Novelty: 0.00002203
p_int: 0.907107395
p_ni: 0.092892605
Score: 0.737
Data Source: BioPlex,STRINGDB
SMAD4
Tbio
Family: TF
Novelty: 0.00064135
Score: 0.967
Data Source: STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.966
Data Source: STRINGDB
SMAD3
Tbio
Family: TF
Novelty: 0.00058288
Score: 0.965
Data Source: STRINGDB
MED1
Tbio
Family: Enzyme
Novelty: 0.01259825
Score: 0.945
Data Source: STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.94
Data Source: STRINGDB
HNF1A
Tbio
Family: TF
Novelty: 0.00145707
Score: 0.933
Data Source: STRINGDB
FOXA2
Tbio
Family: TF
Novelty: 0.00339972
Score: 0.866
Data Source: STRINGDB
SREBF1
Tbio
Family: TF
Novelty: 0.0006792
Score: 0.863
Data Source: STRINGDB
HNF1B
Tbio
Family: TF
Novelty: 0.00239003
Score: 0.856
Data Source: STRINGDB
Publication Statistics
PubMed Score  1435.41

PubMed score by year
PubTator Score  1379.38

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK
1-70
HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR
70-140
RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE
140-210
LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ
210-280
IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ
280-350
MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
350-420
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
420-474
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI