You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PMEL
Melanocyte protein PMEL

Protein Summary
Description
Plays a central role in the biogenesis of melanosomes. Involved in the maturation of melanosomes from stage I to II. The transition from stage I melanosomes to stage II melanosomes involves an elongation of the vesicle, and the appearance within of distinct fibrillar structures. Release of the soluble form, ME20-S, could protect tumor cells from antibody mediated immunity. This gene encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding ma ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000449260
  • ENSP00000402758
  • ENSG00000185664
  • ENST00000548493
  • ENSP00000447374
  • ENST00000548747
  • ENSP00000448828
  • ENST00000550464
  • ENSP00000450036
  • ENST00000552882
  • ENSP00000449690

Symbol
  • D12S53E
  • PMEL17
  • SILV
  • P1
  • SI
  • SIL
  • ME20
  • P100
  • SILV
  • ME20M
  • gp100
  • ME20-M
  • PMEL17
  • D12S53E
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.96
histone modification site profile
0.85
gene perturbation
0.83
biological term
0.64
cell line
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 650.95   (req: < 5)
Gene RIFs: 52   (req: <= 3)
Antibodies: 1014   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 650.95   (req: >= 5)
Gene RIFs: 52   (req: > 3)
Antibodies: 1014   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Protein-Protein Interactions (215)
1 – 10 of 215
ATP2A3
Tbio
Family: Transporter
Novelty: 0.01101086
p_int: 0.999962985
p_ni: 0.000037015
Data Source: BioPlex
TYK2
Tclin
Family: Kinase
Novelty: 0.00331363
p_int: 0.999826399
p_ni: 0.000173594
p_wrong: 7e-9
Data Source: BioPlex
GUSB
Tchem
Family: Enzyme
Novelty: 0.00074055
p_int: 0.999457311
p_ni: 0.000542688
Score: 0.208
Data Source: BioPlex,STRINGDB
TPCN1
Tchem
Family: IC
Novelty: 0.00474422
p_int: 0.998721161
p_ni: 0.001278819
p_wrong: 2.1e-8
Data Source: BioPlex
C17orf80
Tdark
Novelty: 0.25531915
p_int: 0.996622811
p_ni: 0.003377042
p_wrong: 1.48e-7
Data Source: BioPlex
SPDL1
Tbio
Novelty: 0.02478116
p_int: 0.995765595
p_ni: 0.004234393
p_wrong: 1.1e-8
Data Source: BioPlex
SLC27A6
Tbio
Family: Transporter
Novelty: 0.01699786
p_int: 0.99421598
p_ni: 0.00578402
Data Source: BioPlex
MT-ND1
Tclin
Family: Enzyme
Novelty: 0.00152131
p_int: 0.993754958
p_ni: 0.005059289
p_wrong: 0.001185753
Data Source: BioPlex
INTS4
Tbio
Novelty: 0.05555556
p_int: 0.992035721
p_ni: 0.007964279
Data Source: BioPlex
CLCN7
Tchem
Family: IC
Novelty: 0.00978278
p_int: 0.98838694
p_ni: 0.011591249
p_wrong: 0.000021811
Data Source: BioPlex
Publication Statistics
PubMed Score  650.95

PubMed score by year
PubTator Score  392.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKV
1-70
SNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPS
70-140
GSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTIT
140-210
DQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
210-280
LEPGPVTAQVVLQAAIPLTSCGSSPVPGTTDGHRPTAEAPNTTAGQVPTTEVVGTTPGQAPTAEPSGTTS
280-350
VQVPTTEVISTAPVQMPTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTT
350-420
TEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIV
420-490
QGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRLCQPVLPSPACQLVLHQILKG
490-560
GSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQVPLIVGILLVLMAVVLASLIYRRRLMKQDFSVPQL
560-630
PHSSSHWLRLPRIFCSCPIGENSPLLSGQQV
630-661
MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQAAIPLTSCGSSPVPGTTDGHRPTAEAPNTTAGQVPTTEVVGTTPGQAPTAEPSGTTSVQVPTTEVISTAPVQMPTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIVQGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRLCQPVLPSPACQLVLHQILKGGSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQVPLIVGILLVLMAVVLASLIYRRRLMKQDFSVPQLPHSSSHWLRLPRIFCSCPIGENSPLLSGQQV