You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
STAT3
Signal transducer and activator of transcription 3

Protein Summary
Description
Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors (PubMed:10688651, PubMed:12359225, PubMed:12873986, PubMed:15194700, PubMed:17344214, PubMed:18242580, PubMed:23084476). Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene (PubMed:17344214). May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed:12873986). Binds to the interleukin-6 (IL-6)-responsive elements identified in the promoters of various acute-phase protein genes (PubMed:12359225). Activated by IL31 through IL31RA (PubMed:15194700). Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): deacetylation and oxidation of lysine residues by LOXL3, leads to disrupt STAT3 dimerization and inhibit its transcription activity (PubMed:28065600). Involved in cell cycle regulation by i ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264657
  • ENSP00000264657
  • ENSG00000168610
  • ENST00000404395
  • ENSP00000384943
  • ENST00000585517
  • ENSP00000467000
  • ENST00000588969
  • ENSP00000467985

Symbol
  • APRF
  • APRF
  • HIES
  • ADMIO
  • ADMIO1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
disease perturbation
1
hub protein
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7533.36   (req: < 5)
Gene RIFs: 2260   (req: <= 3)
Antibodies: 2254   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7533.36   (req: >= 5)
Gene RIFs: 2260   (req: > 3)
Antibodies: 2254   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 91
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 86
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (263)
Apoptosis (R-HSA-109581)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 56
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Apoptosis
Reactome
Association of TriC/CCT with target proteins during biosynthesis
Reactome
BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
Reactome
Cellular Senescence
Reactome
Cellular responses to external stimuli
Name
Explore in Pharos
Explore in Source
Apoptosis
Association of TriC/CCT with target proteins during biosynthesis
BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
Cellular Senescence
Cellular responses to external stimuli
Gene Ontology Terms (102)
Items per page:
10
1 – 10 of 17
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (958)
1 – 10 of 958
TCEAL1
Tbio
Novelty: 0.03807394
p_int: 0.999948156
p_ni: 0.000051844
Data Source: BioPlex
STAT1
Tchem
Family: TF
Novelty: 0.00041067
p_int: 0.999892474
p_ni: 0.000107526
Score: 0.972
Data Source: BioPlex,Reactome,STRINGDB
TRPV5
Tchem
Family: IC
Novelty: 0.00701642
p_int: 0.999243042
p_ni: 0.000756958
Score: 0.201
Data Source: BioPlex,STRINGDB
CDK15
Tchem
Family: Kinase
Novelty: 3.88235294
p_int: 0.99893754
p_ni: 0.00106246
Score: 0.247
Data Source: BioPlex,STRINGDB
SEMA4C
Tbio
Novelty: 0.01413319
p_int: 0.998572661
p_ni: 0.001427339
Score: 0.194
Data Source: BioPlex,STRINGDB
LRRC32
Tbio
Novelty: 0.02627474
p_int: 0.997710607
p_ni: 0.002289391
p_wrong: 3e-9
Score: 0.25
Data Source: BioPlex,STRINGDB
IL20RA
Tbio
Novelty: 0.03295383
p_int: 0.996430977
p_ni: 0.003569023
Score: 0.955
Data Source: BioPlex,Reactome,STRINGDB
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.995698184
p_ni: 0.004301816
Data Source: BioPlex
RP2
Tbio
Novelty: 0.32
p_int: 0.988967768
p_ni: 0.011032232
Data Source: BioPlex
CACNG2
Tbio
Family: IC
Novelty: 0.01171137
p_int: 0.986765395
p_ni: 0.013234589
p_wrong: 1.6e-8
Score: 0.193
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  7533.36

PubMed score by year
PubTator Score  5289.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSR
1-70
FLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEK
70-140
QQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTAL
140-210
DQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQ
210-280
IKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVR
280-350
LLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
350-420
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNV
420-490
NFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFS
490-560
FWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISG
560-630
KTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG
630-700
SAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
700-770
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM