You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PBX1
Pre-B-cell leukemia transcription factor 1

Protein Summary
Description
Binds the sequence 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. Converted into a potent transcriptional activator by the (1;19) translocation. May have a role in steroidogenesis and, subsequently, sexual development and differentiation. Isoform PBX1b as part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Probably in complex with MEIS2, is involved in transcriptional regulation by KLF4. Acts as a transcriptional activator of NKX2-5 and a transcriptional repressor of CDKN2B. Together with NKX2-5, it is required for spleen development through a mechanism that involves CDKN2B repression (By similarity). This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367897
  • ENSP00000356872
  • ENSG00000185630
  • ENST00000420696
  • ENSP00000405890
  • ENST00000627490
  • ENSP00000485692

Symbol
  • PRL
  • CAKUHED
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
kinase perturbation
0.99
PubMedID
0.95
virus perturbation
0.92
biological process
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 224.67   (req: < 5)
Gene RIFs: 67   (req: <= 3)
Antibodies: 338   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 224.67   (req: >= 5)
Gene RIFs: 67   (req: > 3)
Antibodies: 338   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Activation of HOX genes during differentiation (R-HSA-5619507)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of HOX genes during differentiation
Reactome
Activation of anterior HOX genes in hindbrain development during early embryogenesis
Reactome
Developmental Biology
Reactome
NOTCH3 Intracellular Domain Regulates Transcription
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Activation of HOX genes during differentiation
Activation of anterior HOX genes in hindbrain development during early embryogenesis
Developmental Biology
NOTCH3 Intracellular Domain Regulates Transcription
Signal Transduction
Gene Ontology Terms (29)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Non-traceable Author Statement (NAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (240)
1 – 10 of 240
PKNOX1
Tbio
Family: TF
Novelty: 0.01712074
p_int: 0.999999845
p_ni: 1.55e-7
Score: 0.991
Data Source: BioPlex,Reactome,STRINGDB
MEIS2
Tbio
Family: TF
Novelty: 0.01900867
p_int: 0.999999486
p_ni: 5.14e-7
Score: 0.957
Data Source: BioPlex,STRINGDB
MAB21L1
Tbio
Novelty: 0.10759186
p_int: 0.999896542
p_ni: 0.000103458
Score: 0.85
Data Source: BioPlex,STRINGDB
FAM222A
Tdark
p_int: 0.999040769
p_ni: 0.000959231
Score: 0.828
Data Source: BioPlex,STRINGDB
LMX1B
Tbio
Family: TF
Novelty: 0.00535467
p_int: 0.998790429
p_ni: 0.001209563
p_wrong: 8e-9
Score: 0.822
Data Source: BioPlex,STRINGDB
MAB21L2
Tbio
Novelty: 0.05944378
p_int: 0.998558768
p_ni: 0.001441232
Score: 0.702
Data Source: BioPlex,STRINGDB
VWA5A
Tbio
Novelty: 0.08952043
p_int: 0.99806611
p_ni: 0.00193389
Score: 0.275
Data Source: BioPlex,STRINGDB
C5orf24
Tdark
Novelty: 10
p_int: 0.993276965
p_ni: 0.006723035
Score: 0.373
Data Source: BioPlex,STRINGDB
CCDC120
Tbio
Novelty: 0.71428571
p_int: 0.992458394
p_ni: 0.007541604
p_wrong: 1e-9
Score: 0.269
Data Source: BioPlex,STRINGDB
MAGEA1
Tbio
Novelty: 0.00581327
p_int: 0.986460901
p_ni: 0.013539099
Data Source: BioPlex
Publication Statistics
PubMed Score  224.67

PubMed score by year
PubTator Score  169.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNC
1-70
HRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAG
70-140
SDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSS
140-210
IQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQV
210-280
SNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSV
280-350
QSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
350-420
PGSVHSDTSN
420-430
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN