You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CD79B
B-cell antigen receptor complex-associated protein beta chain

Protein Summary
Description
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000006750
  • ENSP00000006750
  • ENSG00000007312
  • ENST00000349817
  • ENSP00000245862
  • ENST00000392795
  • ENSP00000376544

Symbol
  • B29
  • IGB
  • B29
  • IGB
  • AGM6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
PubMedID
0.72
gene perturbation
0.7
kinase perturbation
0.66
cellular component
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 373.53   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 879   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 373.53   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 879   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Reactome
CD22 mediated BCR regulation
Reactome
Immune System
Reactome
Signaling by the B Cell Receptor (BCR)
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
CD22 mediated BCR regulation
Immune System
Signaling by the B Cell Receptor (BCR)
Protein-Protein Interactions (264)
1 – 10 of 264
TBRG4
Tbio
Novelty: 0.0393341
p_int: 0.999931994
p_ni: 0.000068006
Data Source: BioPlex
NF1
Tbio
Novelty: 0.00021961
p_int: 0.999902981
p_ni: 0.000097019
Score: 0.167
Data Source: BioPlex,STRINGDB
SLC12A6
Tbio
Family: Transporter
Novelty: 0.01603861
p_int: 0.999888941
p_ni: 0.000110315
p_wrong: 7.44e-7
Data Source: BioPlex
TRPM4
Tchem
Family: IC
Novelty: 0.00523602
p_int: 0.999868217
p_ni: 0.000131782
p_wrong: 1e-9
Data Source: BioPlex
TSC2
Tbio
Novelty: 0.00092908
p_int: 0.99975998
p_ni: 0.000239989
p_wrong: 3.1e-8
Data Source: BioPlex
CYBC1
Tdark
Novelty: 0.49659864
p_int: 0.999687343
p_ni: 0.000268796
p_wrong: 0.000043861
Data Source: BioPlex
ENTPD4
Tbio
Family: Enzyme
Novelty: 0.17159199
p_int: 0.999687343
p_ni: 0.000268796
p_wrong: 0.000043861
Data Source: BioPlex
TMTC4
Tdark
Novelty: 0.8
p_int: 0.999679249
p_ni: 0.00032075
Data Source: BioPlex
MANEA
Tbio
Family: Enzyme
Novelty: 0.03417339
p_int: 0.999659198
p_ni: 0.000340802
Data Source: BioPlex
TMUB2
Tdark
Novelty: 15
p_int: 0.999485088
p_ni: 0.000447
p_wrong: 0.000067912
Data Source: BioPlex
Publication Statistics
PubMed Score  373.53

PubMed score by year
PubTator Score  201.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA
1-70
SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL
70-140
RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI
140-210
VTLRTGEVKWSVGEHPGQE
210-229
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE