You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFNGR2
Interferon gamma receptor 2

Protein Summary
Description
Associates with IFNGR1 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:8124716, PubMed:7673114,PubMed:7615558). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:8124716, PubMed:7673114, PubMed:15356148). Required for signal transduction in contrast to other receptor subunit responsible for ligand binding (PubMed:7673114). This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000290219
  • ENSP00000290219
  • ENSG00000159128
  • ENST00000576463
  • ENSP00000458487
  • ENSG00000262795

Symbol
  • IFNGT1
  • AF-1
  • IFGR2
  • IMD28
  • IFNGT1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
kinase perturbation
0.93
transcription factor perturbation
0.91
transcription factor binding site profile
0.77
PubMedID
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49.55   (req: < 5)
Gene RIFs: 47   (req: <= 3)
Antibodies: 383   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49.55   (req: >= 5)
Gene RIFs: 47   (req: > 3)
Antibodies: 383   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (32)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interferon Signaling
Reactome
Interferon gamma signaling
Reactome
Regulation of IFNG signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interferon Signaling
Interferon gamma signaling
Regulation of IFNG signaling
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (102)
1 – 10 of 102
IFNGR1
Tbio
Novelty: 0.00552398
Score: 0.991
Data Source: Reactome,STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.979
Data Source: Reactome,STRINGDB
JAK2
Tclin
Family: Kinase
Novelty: 0.00028252
Score: 0.976
Data Source: Reactome,STRINGDB
IFNG
Tclin
Novelty: 0.00011491
Score: 0.968
Data Source: Reactome,STRINGDB
IFNAR2
Tclin
Novelty: 0.00573978
Score: 0.95
Data Source: STRINGDB
SOCS1
Tbio
Novelty: 0.0006161
Score: 0.935
Data Source: Reactome,STRINGDB
STAT1
Tchem
Family: TF
Novelty: 0.00041067
Score: 0.933
Data Source: Reactome,STRINGDB
SOCS3
Tbio
Novelty: 0.00082008
Score: 0.926
Data Source: Reactome,STRINGDB
PTPN11
Tchem
Family: Enzyme
Novelty: 0.00086268
Score: 0.912
Data Source: Reactome,STRINGDB
CAMK2D
Tchem
Family: Kinase
Novelty: 0.02987369
Score: 0.908
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  49.55

PubMed score by year
PubTator Score  264.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYT
1-70
DSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTV
70-140
GPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCL
140-210
QVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYW
210-280
FHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
280-337
MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL