You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RBMX
RNA-binding motif protein, X chromosome

Protein Summary
Description
RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000320676
  • ENSP00000359645
  • ENSG00000147274
  • ENST00000431446
  • ENSP00000411989

Symbol
  • HNRPG
  • RBMXP1
  • RNMX
  • HNRPG
  • HNRNPG
  • MRXS11
  • RBMXP1
  • RBMXRT
  • hnRNP-G
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
interacting protein
1
ligand (protein) perturbation
0.99
transcription factor perturbation
0.96
disease perturbation
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 43.08   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 143   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 43.08   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 143   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
mRNA Splicing
Reactome
mRNA Splicing - Major Pathway
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
Processing of Capped Intron-Containing Pre-mRNA
mRNA Splicing
mRNA Splicing - Major Pathway
Gene Ontology Terms (30)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (300)
1 – 10 of 300
HPD
Tclin
Family: Enzyme
Novelty: 0.0021957
p_int: 0.999997097
p_ni: 0.000002903
Score: 0.202
Data Source: BioPlex,STRINGDB
RBM45
Tbio
Novelty: 0.09688581
p_int: 0.999799023
p_ni: 0.000200903
p_wrong: 7.4e-8
Score: 0.635
Data Source: BioPlex,STRINGDB
P3H2
Tbio
Family: Enzyme
Novelty: 0.00315791
p_int: 0.999073394
p_ni: 0.000831761
p_wrong: 0.000094845
Score: 0.191
Data Source: BioPlex,STRINGDB
TWNK
Tbio
Novelty: 0.00568711
p_int: 0.998988428
p_ni: 0.001011569
p_wrong: 4e-9
Score: 0.277
Data Source: BioPlex,STRINGDB
NIF3L1
Tbio
Novelty: 0.21052632
p_int: 0.996703019
p_ni: 0.003296981
Score: 0.202
Data Source: BioPlex,STRINGDB
NCOA5
Tbio
Novelty: 0.07301749
p_int: 0.994306071
p_ni: 0.005693738
p_wrong: 1.92e-7
Score: 0.381
Data Source: BioPlex,STRINGDB
YARS2
Tbio
Family: Enzyme
Novelty: 0.00746635
p_int: 0.987418865
p_ni: 0.012581134
Score: 0.522
Data Source: BioPlex,STRINGDB
NGRN
Tbio
Novelty: 0.17990782
p_int: 0.985657655
p_ni: 0.014342345
Data Source: BioPlex
TRUB2
Tdark
Family: Enzyme
Novelty: 0.85714286
p_int: 0.984662841
p_ni: 0.015337159
Score: 0.233
Data Source: BioPlex,STRINGDB
MTERF3
Tdark
Novelty: 0.07686676
p_int: 0.981016527
p_ni: 0.018983473
Data Source: BioPlex
Publication Statistics
PubMed Score  43.08

PubMed score by year
PubTator Score  17.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN
1-70
GKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNM
70-140
SSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPR
140-210
DDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGS
210-280
YRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLP
280-350
PSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
350-391
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY