You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
FDFT1
Squalene synthase

Protein Summary
Description
This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000220584
  • ENSP00000220584
  • ENSG00000079459
  • ENST00000443614
  • ENSP00000390367
  • ENST00000525777
  • ENSP00000436069
  • ENST00000528643
  • ENSP00000431649
  • ENST00000528812
  • ENSP00000431749
  • ENST00000530664
  • ENSP00000432331
  • ENST00000538689
  • ENSP00000444248
  • ENST00000615631
  • ENSP00000481481
  • ENST00000618539
  • ENSP00000480828
  • ENST00000622850
  • ENSP00000484122
  • ENST00000623368
  • ENSP00000485229

Symbol
  • SS
  • SQS
  • DGPT
  • ERG9
  • SQSD
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (chemical)
1
transcription factor perturbation
1
kinase perturbation
0.99
disease perturbation
0.97
interacting protein
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 420.47   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 401   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 420.47   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 401   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 208
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
ibandronic acid
chemical structure image
Protein Data Bank (26)
1 – 5 of 26
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (57)
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of gene expression by SREBF (SREBP)
Reactome
Cholesterol biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of steroids
Name
Explore in Pharos
Explore in Source
Activation of gene expression by SREBF (SREBP)
Cholesterol biosynthesis
Metabolism
Metabolism of lipids
Metabolism of steroids
Protein-Protein Interactions (173)
1 – 10 of 173
USP32
Tbio
Family: Enzyme
Novelty: 0.06653479
p_int: 0.999999775
p_ni: 2.25e-7
Score: 0.239
Data Source: BioPlex,STRINGDB
UNC93B1
Tbio
Novelty: 0.01966959
p_int: 0.999726218
p_ni: 0.000273772
p_wrong: 9e-9
Score: 0.309
Data Source: BioPlex,STRINGDB
CNNM1
Tdark
Novelty: 0.16670044
p_int: 0.999022393
p_ni: 0.00097411
p_wrong: 0.000003497
Score: 0.174
Data Source: BioPlex,STRINGDB
P2RX1
Tchem
Family: IC
Novelty: 0.00376724
p_int: 0.99736686
p_ni: 0.00263314
Score: 0.189
Data Source: BioPlex,STRINGDB
ADGRE5
Tbio
Family: GPCR
Novelty: 0.01324684
p_int: 0.891277721
p_ni: 0.108722279
Data Source: BioPlex
POMT2
Tbio
Family: Enzyme
Novelty: 0.03313606
p_int: 0.777360097
p_ni: 0.222639056
p_wrong: 8.47e-7
Score: 0.205
Data Source: BioPlex,STRINGDB
SQLE
Tchem
Family: Enzyme
Novelty: 0.01030355
Score: 0.997
Data Source: STRINGDB
FDPS
Tclin
Family: Enzyme
Novelty: 0.00202381
Score: 0.997
Data Source: STRINGDB
GGPS1
Tchem
Family: Enzyme
Novelty: 0.00446019
Score: 0.995
Data Source: STRINGDB
LSS
Tchem
Family: Enzyme
Novelty: 0.00164545
Score: 0.992
Data Source: STRINGDB
Publication Statistics
PubMed Score  420.47

PubMed score by year
PubTator Score  171.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVC
1-70
IFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQ
70-140
TVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLF
140-210
LQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRL
210-280
RNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP
280-350
DSDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH
350-417
MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH