You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SERPINB5
Serpin B5

Protein Summary
Description
Tumor suppressor. It blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000382771
  • ENSP00000372221
  • ENSG00000206075
  • ENST00000489441
  • ENSP00000467158

Symbol
  • PI5
  • PI5
  • maspin
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.73
gene perturbation
0.67
biological term
0.61
small molecule perturbation
0.61
microRNA
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 562.85   (req: < 5)
Gene RIFs: 205   (req: <= 3)
Antibodies: 508   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 562.85   (req: >= 5)
Gene RIFs: 205   (req: > 3)
Antibodies: 508   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (161)
1 – 10 of 161
FCF1
Tdark
Novelty: 0.00913312
p_int: 0.999777778
p_ni: 0.000222219
p_wrong: 3e-9
Data Source: BioPlex
TBC1D22B
Tbio
Novelty: 6
p_int: 0.99963587
p_ni: 0.00036413
Data Source: BioPlex
GPR18
Tchem
Family: GPCR
Novelty: 0.02758408
p_int: 0.998791707
p_ni: 0.001208293
Data Source: BioPlex
RBM24
Tbio
Novelty: 0.05713269
p_int: 0.998406023
p_ni: 0.001593977
Data Source: BioPlex
MMP14
Tchem
Family: Enzyme
Novelty: 0.00092685
p_int: 0.997872658
p_ni: 0.002127342
Data Source: BioPlex
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.997774638
p_ni: 0.002225362
Data Source: BioPlex
CCDC82
Tdark
Novelty: 5
p_int: 0.997732415
p_ni: 0.002267585
Data Source: BioPlex
CDK15
Tchem
Family: Kinase
Novelty: 3.88235294
p_int: 0.997471483
p_ni: 0.002528515
p_wrong: 2e-9
Data Source: BioPlex
EIF2A
Tbio
Novelty: 0.16696482
p_int: 0.996755446
p_ni: 0.003032277
p_wrong: 0.000212276
Score: 0.183
Data Source: BioPlex,STRINGDB
GDF5
Tbio
Novelty: 0.00262695
p_int: 0.995854452
p_ni: 0.004145548
Data Source: BioPlex
Publication Statistics
PubMed Score  562.85

PubMed score by year
PubTator Score  399

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGF
1-70
QTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLT
70-140
DGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNMEATFCMGNID
140-210
SINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEK
210-280
MIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNA
280-350
DHPFIYIIRHNKTRNIIFFGKFCSP
350-375
MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRHNKTRNIIFFGKFCSP