You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CHRNA7
Neuronal acetylcholine receptor subunit alpha-7

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin. The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it un ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306901
  • ENSP00000303727
  • ENSG00000175344
  • ENST00000437966
  • ENSP00000399087
  • ENST00000454250
  • ENSP00000407546

Symbol
  • NACHRA7
  • NACHRA7
  • CHRNA7-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 137.38   (req: < 5)
Gene RIFs: 215   (req: <= 3)
Antibodies: 288   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 137.38   (req: >= 5)
Gene RIFs: 215   (req: > 3)
Antibodies: 288   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 47
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 470
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 9
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Postsynaptic nicotinic acetylcholine receptors
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Postsynaptic nicotinic acetylcholine receptors
Gene Ontology Terms (57)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
ARUK-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
ARUK-UCL
Protein-Protein Interactions (79)
1 – 10 of 79
CHRNB2
Tclin
Family: IC
Novelty: 0.02119739
Score: 0.937
Data Source: STRINGDB
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
Score: 0.933
Data Source: STRINGDB
CHRNA4
Tclin
Family: IC
Novelty: 0.00260286
Score: 0.926
Data Source: STRINGDB
CHRNA6
Tchem
Family: IC
Novelty: 0.05805561
Score: 0.924
Data Source: STRINGDB
CHRNA2
Tchem
Family: IC
Novelty: 0.03966016
Score: 0.924
Data Source: STRINGDB
CHRNA5
Tbio
Family: IC
Novelty: 0.0060853
Score: 0.923
Data Source: STRINGDB
CHRNA3
Tclin
Family: IC
Novelty: 0.00918226
Score: 0.923
Data Source: STRINGDB
CHRNA1
Tclin
Family: IC
Novelty: 0.01910227
Score: 0.922
Data Source: STRINGDB
CHRNA9
Tchem
Family: IC
Novelty: 0.07858477
Score: 0.922
Data Source: STRINGDB
CHRNB3
Tchem
Family: IC
Novelty: 0.04622453
Score: 0.922
Data Source: STRINGDB
Publication Statistics
PubMed Score  137.38

PubMed score by year
PubTator Score  278.27

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQ
1-70
VLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQY
70-140
LPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFY
140-210
ECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVA
210-280
EIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE
280-350
DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
350-420
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSA
420-490
PNFVEAVSKDFA
490-502
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA