You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ARL2
ADP-ribosylation factor-like protein 2

Protein Summary
Description
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle. This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ri ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000246747
  • ENSP00000246747
  • ENSG00000213465
  • ENST00000529384
  • ENSP00000436021
  • ENST00000533729
  • ENSP00000432971

Symbol
  • ARFL2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
molecular function
0.98
cellular component
0.89
histone modification site profile
0.87
transcription factor binding site profile
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.82   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 345   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.82   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 345   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-chaperonin tubulin folding pathway
Reactome
Protein folding
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-chaperonin tubulin folding pathway
Protein folding
SLC-mediated transmembrane transport
Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane
Gene Ontology Terms (21)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (69)
1 – 10 of 69
WDR17
Tdark
Novelty: 0.63157895
p_int: 0.999999994
p_ni: 6e-9
Data Source: BioPlex
TUBB2B
Tclin
Novelty: 0.04266415
p_int: 0.999999703
p_ni: 2.96e-7
Score: 0.934
Data Source: BioPlex,STRINGDB
TUBB2A
Tclin
Novelty: 0.02116297
p_int: 0.999998949
p_ni: 0.000001051
Score: 0.973
Data Source: BioPlex,STRINGDB
TUBB
Tclin
Novelty: 0.00489923
p_int: 0.999998154
p_ni: 0.000001846
Score: 0.621
Data Source: BioPlex,STRINGDB
ARL2BP
Tbio
Novelty: 0.08238566
p_int: 0.999997653
p_ni: 0.000002346
p_wrong: 2e-9
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
CFAP36
Tdark
Novelty: 0.5060241
p_int: 0.999996203
p_ni: 0.000003774
p_wrong: 2.3e-8
Score: 0.574
Data Source: BioPlex,STRINGDB
TBCD
Tbio
Novelty: 0.01673453
p_int: 0.999992045
p_ni: 0.000007955
Score: 0.997
Data Source: BioPlex,STRINGDB
ALPI
Tbio
Family: Enzyme
Novelty: 0.00247141
p_int: 0.999955728
p_ni: 0.000044238
p_wrong: 3.4e-8
Score: 0.188
Data Source: BioPlex,STRINGDB
NCR3LG1
Tbio
Novelty: 0.03574232
p_int: 0.999926703
p_ni: 0.000071861
p_wrong: 0.000001436
Data Source: BioPlex
PTPDC1
Tdark
Family: Enzyme
Novelty: 0.65980844
p_int: 0.999866684
p_ni: 0.000132778
p_wrong: 5.38e-7
Score: 0.228
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  41.82

PubMed score by year
PubTator Score  31.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQ
1-70
KSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE
70-140
VLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
140-184
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD