You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PPM1A
Protein phosphatase 1A

Protein Summary
Description
Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. Dephosphorylates PRKAA1 and PRKAA2. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB. The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to acti ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000325642
  • ENSP00000327255
  • ENSG00000100614
  • ENST00000325658
  • ENSP00000314850
  • ENST00000395076
  • ENSP00000378514

Symbol
  • PPPM1A
  • PP2CA
  • PP2Calpha
  • PP2C-ALPHA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
1
transcription factor perturbation
0.98
biological process
0.96
virus perturbation
0.96
microRNA
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 54.85   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 414   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 54.85   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 414   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL444092
chemical structure image
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (87)
Downregulation of SMAD2/3:SMAD4 transcriptional activity (R-HSA-2173795)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Downregulation of SMAD2/3:SMAD4 transcriptional activity
Reactome
Energy dependent regulation of mTOR by LKB1-AMPK
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Downregulation of SMAD2/3:SMAD4 transcriptional activity
Energy dependent regulation of mTOR by LKB1-AMPK
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
Gene Ontology Terms (26)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (110)
1 – 10 of 110
PPM1B
Tchem
Family: Enzyme
Novelty: 0.02552183
p_int: 0.999999759
p_ni: 2.41e-7
Score: 0.719
Data Source: BioPlex,STRINGDB
INPPL1
Tchem
Family: Enzyme
Novelty: 0.00821462
p_int: 0.999994066
p_ni: 0.000005934
Score: 0.176
Data Source: BioPlex,STRINGDB
HAO2
Tchem
Family: Enzyme
Novelty: 0.05085077
p_int: 0.999959923
p_ni: 0.000040077
Score: 0.176
Data Source: BioPlex,STRINGDB
CERKL
Tbio
Family: Enzyme
Novelty: 0.0547283
p_int: 0.999958076
p_ni: 0.000041924
Score: 0.527
Data Source: BioPlex,STRINGDB
RNASE13
Tbio
Family: Enzyme
Novelty: 0.07039696
p_int: 0.999741087
p_ni: 0.000258913
Score: 0.169
Data Source: BioPlex,STRINGDB
PLA2G2D
Tchem
Family: Enzyme
Novelty: 0.00127599
p_int: 0.999345693
p_ni: 0.0006543
p_wrong: 8e-9
Data Source: BioPlex
PRSS22
Tdark
Family: Enzyme
Novelty: 0.32419915
p_int: 0.998435309
p_ni: 0.001564691
Score: 0.297
Data Source: BioPlex,STRINGDB
IL20
Tbio
Novelty: 2
p_int: 0.998006335
p_ni: 0.001924359
p_wrong: 0.000069306
Data Source: BioPlex
GDF3
Tbio
Novelty: 0.01421572
p_int: 0.996357878
p_ni: 0.003642122
Score: 0.303
Data Source: BioPlex,STRINGDB
TECPR2
Tbio
Novelty: 0.21052632
p_int: 0.996212983
p_ni: 0.003787016
Score: 0.187
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  54.85

PubMed score by year
PubTator Score  68.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKY
1-70
CCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY
70-140
FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGP
140-210
TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGS
210-280
RDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGE
280-350
LASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW
350-382
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW