Protein Classes
Protein Summary
Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. Dephosphorylates PRKAA1 and PRKAA2. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB. The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to acti ...more
- ENST00000325642
- ENSP00000327255
- ENSG00000100614
- ENST00000325658
- ENSP00000314850
- ENST00000395076
- ENSP00000378514
- PPPM1A
- PP2CA
- PP2Calpha
- PP2C-ALPHA
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
kinase perturbation | 1 | ||
transcription factor perturbation | 0.98 | ||
biological process | 0.96 | ||
virus perturbation | 0.96 | ||
microRNA | 0.91 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 54.85 (req: < 5)
Gene RIFs: 30 (req: <= 3)
Antibodies: 414 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 54.85 (req: >= 5)
Gene RIFs: 30 (req: > 3)
Antibodies: 414 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 21
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 1
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (1)
1 – 1 of 1
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (87)
Reactome (10)
KEGG (1)
PathwayCommons (3)
WikiPathways (73)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 10
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Downregulation of SMAD2/3:SMAD4 transcriptional activity | ||||
Reactome | Energy dependent regulation of mTOR by LKB1-AMPK | ||||
Reactome | Gene expression (Transcription) | ||||
Reactome | Generic Transcription Pathway | ||||
Reactome | RNA Polymerase II Transcription | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Downregulation of SMAD2/3:SMAD4 transcriptional activity | ||||
Energy dependent regulation of mTOR by LKB1-AMPK | ||||
Gene expression (Transcription) | ||||
Generic Transcription Pathway | ||||
RNA Polymerase II Transcription | ||||
Gene Ontology Terms (26)
Functions (5)
Components (5)
Processes (16)
Items per page:
10
1 – 5 of 5
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (110)
1 – 10 of 110
PPM1B
Family: Enzyme
Novelty: 0.02552183
p_int: 0.999999759
p_ni: 2.41e-7
Score: 0.719
Data Source: BioPlex,STRINGDB
INPPL1
Family: Enzyme
Novelty: 0.00821462
p_int: 0.999994066
p_ni: 0.000005934
Score: 0.176
Data Source: BioPlex,STRINGDB
HAO2
Family: Enzyme
Novelty: 0.05085077
p_int: 0.999959923
p_ni: 0.000040077
Score: 0.176
Data Source: BioPlex,STRINGDB
CERKL
Family: Enzyme
Novelty: 0.0547283
p_int: 0.999958076
p_ni: 0.000041924
Score: 0.527
Data Source: BioPlex,STRINGDB
RNASE13
Family: Enzyme
Novelty: 0.07039696
p_int: 0.999741087
p_ni: 0.000258913
Score: 0.169
Data Source: BioPlex,STRINGDB
PLA2G2D
Family: Enzyme
Novelty: 0.00127599
p_int: 0.999345693
p_ni: 0.0006543
p_wrong: 8e-9
Data Source: BioPlex
PRSS22
Family: Enzyme
Novelty: 0.32419915
p_int: 0.998435309
p_ni: 0.001564691
Score: 0.297
Data Source: BioPlex,STRINGDB
IL20
Novelty: 2
p_int: 0.998006335
p_ni: 0.001924359
p_wrong: 0.000069306
Data Source: BioPlex
GDF3
Novelty: 0.01421572
p_int: 0.996357878
p_ni: 0.003642122
Score: 0.303
Data Source: BioPlex,STRINGDB
TECPR2
Novelty: 0.21052632
p_int: 0.996212983
p_ni: 0.003787016
Score: 0.187
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 54.85
PubMed score by year
PubTator Score 68.07
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKY
1-70
CCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY
70-140
FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGP
140-210
TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGS
210-280
RDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGE
280-350
LASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW
350-382
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW
Find similar targets by: