You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TIE1
Tyrosine-protein kinase receptor Tie-1

Protein Summary
Description
Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis. This gene encodes a member of the tyrosine protein kinase family. The encoded protein plays a critical role in angiogenesis and blood vessel stability by inhibiting angiopoietin 1 signaling through the endothelial receptor tyrosine kinase Tie2. Ectodomain cleavage of the encoded protein relieves inhibition of Tie2 and is mediated by multiple factors including vascular endothelial growth factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372476
  • ENSP00000361554
  • ENSG00000066056
  • ENST00000538015
  • ENSP00000440063

Symbol
  • TIE
  • TIE
  • JTK14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
molecular function
0.98
PubMedID
0.73
co-expressed gene
0.69
tissue sample
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 290.5   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 664   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 290.5   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 664   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 5
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (181)
Items per page:
1 – 5 of 181
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
RAC1/PAK1/p38/MMP2 Pathway
WikiPathways
RAC1/PAK1/p38/MMP2 Pathway
WikiPathways
RAC1/PAK1/p38/MMP2 Pathway
WikiPathways
RAC1/PAK1/p38/MMP2 Pathway
WikiPathways
RAC1/PAK1/p38/MMP2 Pathway
Name
Explore in Pharos
Explore in Source
RAC1/PAK1/p38/MMP2 Pathway
RAC1/PAK1/p38/MMP2 Pathway
RAC1/PAK1/p38/MMP2 Pathway
RAC1/PAK1/p38/MMP2 Pathway
RAC1/PAK1/p38/MMP2 Pathway
Protein-Protein Interactions (52)
1 – 10 of 52
CFI
Tbio
Novelty: 0.00194994
Score: 0.827
Data Source: STRINGDB
ANGPT2
Tbio
Novelty: 0.0014012
Score: 0.821
Data Source: STRINGDB
ANGPT1
Tbio
Novelty: 0.00129574
Score: 0.78
Data Source: STRINGDB
ANGPT4
Tbio
Novelty: 0.05155686
Score: 0.776
Data Source: STRINGDB
ANGPTL1
Tbio
Novelty: 0.03960484
Score: 0.755
Data Source: STRINGDB
VEGFA
Tclin
Novelty: 0.00004909
Score: 0.723
Data Source: STRINGDB
CDH5
Tbio
Novelty: 0.00096405
Score: 0.715
Data Source: STRINGDB
PECAM1
Tbio
Novelty: 0.00020273
Score: 0.665
Data Source: STRINGDB
ANGPTL2
Tbio
Novelty: 0.01289757
Score: 0.652
Data Source: STRINGDB
ANGPTL3
Tbio
Novelty: 0.00854556
Score: 0.63
Data Source: STRINGDB
Publication Statistics
PubMed Score  290.50

PubMed score by year
PubTator Score  95.5

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIV
1-70
RTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGD
70-140
TAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRL
140-210
IVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRG
210-280
LTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRI
280-350
PQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD
350-420
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDST
420-490
MDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTD
490-560
RLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGP
560-630
ASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEE
630-700
TSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVS
700-770
ATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT
770-840
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNR
840-910
GYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDL
910-980
AARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLG
980-1050
GTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNM
1050-1120
SLFENFTYAGIDATAEEA
1120-1138
MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA