You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IDUA
Alpha-L-iduronidase

Protein Summary
Description
This gene encodes an enzyme that hydrolyzes the terminal alpha-L-iduronic acid residues of two glycosaminoglycans, dermatan sulfate and heparan sulfate. This hydrolysis is required for the lysosomal degradation of these glycosaminoglycans. Mutations in this gene that result in enzymatic deficiency lead to the autosomal recessive disease mucopolysaccharidosis type I (MPS I). [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000247933
  • ENSP00000247933
  • ENSG00000127415

Symbol
  • IDA
  • MPS1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.81
cellular component
0.77
transcription factor binding site profile
0.72
phenotype
0.69
PubMedID
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 314.43   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 182   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 314.43   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 182   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
CS/DS degradation (R-HSA-2024101)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
CS/DS degradation
Reactome
Chondroitin sulfate/dermatan sulfate metabolism
Reactome
Disease
Reactome
Diseases of carbohydrate metabolism
Reactome
Diseases of metabolism
Name
Explore in Pharos
Explore in Source
CS/DS degradation
Chondroitin sulfate/dermatan sulfate metabolism
Disease
Diseases of carbohydrate metabolism
Diseases of metabolism
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (52)
1 – 10 of 52
SCGB2A2
Tbio
Novelty: 0.01762536
p_int: 0.998595139
p_ni: 0.000001655
p_wrong: 0.001403207
Score: 0.188
Data Source: BioPlex,STRINGDB
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.990684104
p_ni: 0.002151234
p_wrong: 0.007164662
Data Source: BioPlex
IDS
Tbio
Family: Enzyme
Novelty: 0.0090788
Score: 0.97
Data Source: STRINGDB
SGSH
Tbio
Family: Enzyme
Novelty: 0.00630911
Score: 0.968
Data Source: STRINGDB
ARSB
Tbio
Family: Enzyme
Novelty: 0.00299621
Score: 0.966
Data Source: STRINGDB
HEXA
Tchem
Family: Enzyme
Novelty: 0.00302415
Score: 0.932
Data Source: STRINGDB
HYAL1
Tbio
Family: Enzyme
Novelty: 0.01040168
Score: 0.923
Data Source: STRINGDB
SPAM1
Tbio
Family: Enzyme
Novelty: 0.00505307
Score: 0.92
Data Source: STRINGDB
HYAL4
Tbio
Family: Enzyme
Novelty: 0.15189873
Score: 0.912
Data Source: STRINGDB
HYAL3
Tbio
Family: Enzyme
Novelty: 0.19292605
Score: 0.902
Data Source: STRINGDB
Publication Statistics
PubMed Score  314.43

PubMed score by year
PubTator Score  429.66

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPLRPRAALLALLASLLAAPPVAPAEAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQ
1-70
QLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHF
70-140
TDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLR
140-210
AASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVA
210-280
QQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDN
280-350
AFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGV
350-420
LASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRL
420-490
GRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLT
490-560
QGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPG
560-630
PFSDPVPYLEVPVPRGPPSPGNP
630-653
MRPLRPRAALLALLASLLAAPPVAPAEAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP