You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SFTPD
Pulmonary surfactant-associated protein D

Protein Classes
Protein Summary
Description
Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism. [provided by RefSeq, Jul 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372292
  • ENSP00000361366
  • ENSG00000133661

Symbol
  • COLEC7
  • PSPD
  • SFTP4
  • SP-D
  • PSP-D
  • SFTP4
  • COLEC7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.95
protein domain
0.85
biological process
0.82
PubMedID
0.74
disease
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 827.46   (req: < 5)
Gene RIFs: 184   (req: <= 3)
Antibodies: 456   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 827.46   (req: >= 5)
Gene RIFs: 184   (req: > 3)
Antibodies: 456   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (27)
1 – 5 of 27
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (137)
Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4) (R-HSA-5688890)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4)
Reactome
Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5)
Reactome
Disease
Reactome
Diseases associated with surfactant metabolism
Reactome
Diseases of metabolism
Name
Explore in Pharos
Explore in Source
Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4)
Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5)
Disease
Diseases associated with surfactant metabolism
Diseases of metabolism
Protein-Protein Interactions (53)
1 – 10 of 53
SFTPB
Tbio
Novelty: 0.00138979
Score: 0.988
Data Source: STRINGDB
DMBT1
Tbio
Novelty: 0.004488
Score: 0.988
Data Source: Reactome,STRINGDB
SFTPC
Tbio
Novelty: 0.00174879
Score: 0.985
Data Source: STRINGDB
SFTPA1
Tbio
Novelty: 0.00575742
Score: 0.956
Data Source: STRINGDB
SFTPA2
Tbio
Novelty: 0.00332747
Score: 0.942
Data Source: STRINGDB
CSF2RB
Tclin
Novelty: 0.0255155
Score: 0.923
Data Source: STRINGDB
SFTA3
Tbio
Novelty: 0.00103387
Score: 0.922
Data Source: STRINGDB
CSF2RA
Tclin
Novelty: 0.00203341
Score: 0.921
Data Source: STRINGDB
MFAP4
Tbio
Novelty: 0.03267874
Score: 0.903
Data Source: STRINGDB
CKAP4
Tbio
Novelty: 0.02797536
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score  827.46

PubMed score by year
PubTator Score  737.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPG
1-70
AAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGE
70-140
AGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIP
140-210
GDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLL
210-280
CTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSED
280-350
CVEIFTNGKWNDRACGEKRLVVCEF
350-375
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF