You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RDX
Radixin

Protein Summary
Description
Probably plays a crucial role in the binding of the barbed end of actin filaments to the plasma membrane. Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000343115
  • ENSP00000342830
  • ENSG00000137710
  • ENST00000405097
  • ENSP00000384136
  • ENST00000528498
  • ENSP00000432112
  • ENST00000528900
  • ENSP00000433580
  • ENST00000530301
  • ENSP00000436277
  • ENST00000530749
  • ENSP00000437301
  • ENST00000544551
  • ENSP00000445826
  • ENST00000645495
  • ENSP00000496503
  • ENST00000647231
  • ENSP00000496414

Symbol
  • DFNB24
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
disease perturbation
0.98
kinase
0.91
interacting protein
0.9
transcription factor perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 233.41   (req: < 5)
Gene RIFs: 60   (req: <= 3)
Antibodies: 407   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 233.41   (req: >= 5)
Gene RIFs: 60   (req: > 3)
Antibodies: 407   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 33
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (25)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
L1CAM interactions
Reactome
Recycling pathway of L1
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
L1CAM interactions
Recycling pathway of L1
Gene Ontology Terms (51)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (166)
1 – 10 of 166
EZR
Tbio
Novelty: 0.00130199
p_int: 0.999995925
p_ni: 0.000004075
Score: 0.938
Data Source: BioPlex,STRINGDB
SLC9A3R2
Tbio
Family: Transporter
Novelty: 0.01296563
p_int: 0.917561397
p_ni: 0.082438603
Score: 0.929
Data Source: BioPlex,STRINGDB
MRPL12
Tbio
Novelty: 0.16043959
p_int: 0.916106026
p_ni: 0.083893974
Score: 0.186
Data Source: BioPlex,STRINGDB
MISP
Tbio
Novelty: 0.01696113
p_int: 0.85536046
p_ni: 0.14463954
Score: 0.345
Data Source: BioPlex,STRINGDB
SLC9A3R1
Tbio
Family: Transporter
Novelty: 0.0026167
Score: 0.974
Data Source: STRINGDB
ROCK1
Tclin
Family: Kinase
Novelty: 0.00196146
Score: 0.973
Data Source: STRINGDB
ROCK2
Tclin
Family: Kinase
Novelty: 0.00286446
Score: 0.968
Data Source: STRINGDB
L1CAM
Tbio
Novelty: 0.00153954
Score: 0.954
Data Source: STRINGDB
CLTC
Tbio
Novelty: 0.00348813
Score: 0.918
Data Source: STRINGDB
AP2A2
Tbio
Novelty: 0.19247594
Score: 0.903
Data Source: STRINGDB
Publication Statistics
PubMed Score  233.41

PubMed score by year
PubTator Score  683.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDV
1-70
KKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKE
70-140
IHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKN
140-210
KKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI
210-280
LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMER
280-350
LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
350-420
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHD
420-490
ENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD
490-560
KYKTLRQIRQGNTKQRIDEFEAM
560-583
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM