You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CA5A
Carbonic anhydrase 5A, mitochondrial

Protein Summary
Description
Reversible hydration of carbon dioxide. Low activity. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309893
  • ENSP00000309649
  • ENSG00000174990
  • ENST00000649794
  • ENSP00000498065

Symbol
  • CA5
  • CA5
  • CAV
  • CAVA
  • CA5AD
  • GS1-21A4.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.6
kinase perturbation
0.54
chemical
0.51
disease perturbation
0.49
PubMedID
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 306.06   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 130   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 306.06   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 130   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 123
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 14
Pathways (4)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Reversible hydration of carbon dioxide
Name
Explore in Pharos
Explore in Source
Metabolism
Reversible hydration of carbon dioxide
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (25)
1 – 10 of 25
PMPCA
Tbio
Family: Enzyme
Novelty: 0.00992842
p_int: 0.795404378
p_ni: 0.204595622
Score: 0.195
Data Source: BioPlex,STRINGDB
SIRT3
Tchem
Family: Epigenetic
Novelty: 0.00132584
p_int: 0.758652554
p_ni: 0.241347179
p_wrong: 2.66e-7
Score: 0.214
Data Source: BioPlex,STRINGDB
CYP24A1
Tchem
Family: Enzyme
Novelty: 0.00108437
Score: 0.798
Data Source: STRINGDB
THRSP
Tbio
Novelty: 0.00422168
Score: 0.718
Data Source: STRINGDB
UHMK1
Tbio
Family: Kinase
Novelty: 0.00180095
Score: 0.67
Data Source: STRINGDB
MT-CO3
Tbio
Family: Enzyme
Novelty: 0.00050353
Score: 0.6
Data Source: STRINGDB
SNRPB
Tbio
Novelty: 0.01137048
Score: 0.579
Data Source: STRINGDB
SLC4A4
Tbio
Family: Transporter
Novelty: 0.00221797
Score: 0.549
Data Source: STRINGDB
TXNRD2
Tbio
Family: Enzyme
Novelty: 0.00232135
Score: 0.539
Data Source: STRINGDB
SLC9A1
Tchem
Family: Transporter
Novelty: 0.00112175
Score: 0.537
Data Source: STRINGDB
Publication Statistics
PubMed Score  306.06

PubMed score by year
PubTator Score  182.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQ
1-70
WRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGG
70-140
SEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARA
140-210
AMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNN
210-280
YRPLQPLMNRKVWASFQATNEGTRS
280-305
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS