You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BTC
Probetacellulin

Protein Summary
Description
Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. This gene encodes a member of the epidermal growth factor (EGF) family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the secreted growth factor. A secreted form and a membrane-anchored form of this protein bind to multiple different EGF receptors. This protein promotes pancreatic cell proliferation and insulin secretion, as well as retinal vascular permeability. Mutations in this gene may be associated with type 2 diabetes in human patients. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000395743
  • ENSP00000379092
  • ENSG00000174808
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.96
transcription factor perturbation
0.8
gene perturbation
0.65
histone modification site profile
0.59
cell type or tissue
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 820.88   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 386   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 820.88   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 386   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (217)
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 48
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Gene Ontology Terms (21)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (87)
1 – 10 of 87
EIF2B4
Tbio
Novelty: 0.07295839
p_int: 0.999929358
p_ni: 0.000070642
Data Source: BioPlex
ZDHHC6
Tbio
Family: Enzyme
Novelty: 0.25862069
p_int: 0.99983558
p_ni: 0.000139048
p_wrong: 0.000025372
Score: 0.281
Data Source: BioPlex,STRINGDB
EIF2B1
Tbio
Novelty: 0.03209084
p_int: 0.999830928
p_ni: 0.000169072
Data Source: BioPlex
EIF2B3
Tbio
Novelty: 0.05806987
p_int: 0.999615122
p_ni: 0.000384878
Data Source: BioPlex
GALNT12
Tbio
Family: Enzyme
Novelty: 0.10850923
p_int: 0.999573339
p_ni: 0.000426661
Data Source: BioPlex
ZDHHC20
Tbio
Family: Enzyme
Novelty: 0.3
p_int: 0.999500395
p_ni: 0.000007095
p_wrong: 0.00049251
Data Source: BioPlex
EIF2B5
Tbio
Novelty: 0.01114599
p_int: 0.999454458
p_ni: 0.000545542
Data Source: BioPlex
EIF2B2
Tbio
Novelty: 0.04147594
p_int: 0.999312914
p_ni: 0.000687086
Data Source: BioPlex
CALHM4
Tdark
Family: IC
p_int: 0.998161643
p_ni: 0.000913317
p_wrong: 0.00092504
Data Source: BioPlex
S100A3
Tbio
Novelty: 0.0418135
p_int: 0.997901357
p_ni: 0.00093788
p_wrong: 0.001160762
Data Source: BioPlex
Publication Statistics
PubMed Score  820.88

PubMed score by year
PubTator Score  55.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCP
1-70
KQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCT
70-140
CCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
140-178
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA