Protein Summary
Cell surface proteoglycan that bears heparan sulfate. Binds, via the heparan sulfate side chains, alpha-4 (V) collagen and participates in Schwann cell myelination (By similarity). May act as a catalyst in increasing the rate of conversion of prion protein PRPN(C) to PRNP(Sc) via associating (via the heparan sulfate side chains) with both forms of PRPN, targeting them to lipid rafts and facilitating their interaction. Required for proper skeletal muscle differentiation by sequestering FGF2 in lipid rafts preventing its binding to receptors (FGFRs) and inhibiting the FGF-mediated signaling. Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division ...more
- ENST00000264039
- ENSP00000264039
- ENSG00000063660
- glypican
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
cellular component | 0.91 | ||
PubMedID | 0.88 | ||
transcription factor perturbation | 0.84 | ||
gene perturbation | 0.83 | ||
biological process | 0.81 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 255.08 (req: < 5)
Gene RIFs: 31 (req: <= 3)
Antibodies: 291 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 255.08 (req: >= 5)
Gene RIFs: 31 (req: > 3)
Antibodies: 291 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 13
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (45)
Reactome (29)
KEGG (2)
PathwayCommons (10)
WikiPathways (4)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 29
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | A tetrasaccharide linker sequence is required for GAG synthesis | ||||
Reactome | Axon guidance | ||||
Reactome | Cell surface interactions at the vascular wall | ||||
Reactome | Chondroitin sulfate/dermatan sulfate metabolism | ||||
Reactome | Defective B3GALT6 causes EDSP2 and SEMDJL1 | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
A tetrasaccharide linker sequence is required for GAG synthesis | ||||
Axon guidance | ||||
Cell surface interactions at the vascular wall | ||||
Chondroitin sulfate/dermatan sulfate metabolism | ||||
Defective B3GALT6 causes EDSP2 and SEMDJL1 | ||||
Gene Ontology Terms (28)
Functions (3)
Components (15)
Processes (10)
Items per page:
10
1 – 3 of 3
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Sequence or structural Similarity (ISS) | UniProtKB | |||
Inferred from Sequence or structural Similarity (ISS) | UniProtKB | |||
Protein-Protein Interactions (184)
1 – 10 of 184
HADHA
Novelty: 0.00234785
p_int: 0.999999993
p_ni: 6e-9
Data Source: BioPlex
GPR183
Family: GPCR
Novelty: 0.021257
p_int: 0.999999528
p_ni: 4.72e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
CAMKV
Family: Kinase
Novelty: 0.02297481
p_int: 0.999998743
p_ni: 0.000001255
p_wrong: 2e-9
Data Source: BioPlex
HADHB
Family: Enzyme
Novelty: 0.01003327
p_int: 0.999988623
p_ni: 0.000011377
Score: 0.173
Data Source: BioPlex,STRINGDB
FGF1
Novelty: 0.00060955
p_int: 0.999973568
p_ni: 0.000026428
p_wrong: 4e-9
Score: 0.455
Data Source: BioPlex,STRINGDB
USP3
Family: Enzyme
Novelty: 0.05837408
p_int: 0.999900865
p_ni: 0.000008558
p_wrong: 0.000090577
Score: 0.237
Data Source: BioPlex,STRINGDB
LRRTM4
Novelty: 0.17645205
p_int: 0.999675416
p_ni: 0.000077635
p_wrong: 0.000246949
Score: 0.647
Data Source: BioPlex,STRINGDB
FANCE
Novelty: 0.07345774
p_int: 0.997813997
p_ni: 0.002185393
p_wrong: 6.1e-7
Score: 0.188
Data Source: BioPlex,STRINGDB
ATP2B4
Family: Transporter
Novelty: 0.00694066
p_int: 0.994688868
p_ni: 0.005311132
Score: 0.159
Data Source: BioPlex,STRINGDB
TMEM245
Novelty: 0.48387097
p_int: 0.97341259
p_ni: 0.026418663
p_wrong: 0.000168747
Score: 0.161
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 255.08
PubMed score by year
PubTator Score 122.55
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCT
1-70
SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARA
70-140
FRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELR
140-210
LRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCL
210-280
ANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNP
280-350
QGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA
350-420
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGS
420-490
GDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR
490-558
MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR
Find similar targets by: