You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
EPHX2
Bifunctional epoxide hydrolase 2

Protein Summary
Description
Bifunctional enzyme (PubMed:12574510). The C-terminal domain has epoxide hydrolase activity and acts on epoxides (alkene oxides, oxiranes) and arene oxides (PubMed:12869654, PubMed:12574510, PubMed:22798687). Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides (By similarity). Also determines steady-state levels of physiological mediators (PubMed:12869654, PubMed:12574510, PubMed:22798687). The N-terminal domain has lipid phosphatase activity, with the highest activity towards threo-9,10-phosphonooxy-hydroxy-octadecanoic acid, followed by erythro-9,10-phosphonooxy-hydroxy-octadecanoic acid, 12-phosphonooxy-octadec-9Z-enoic acid and 12-phosphonooxy-octadec-9E-enoic acid (PubMed:12574510). This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. A ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380476
  • ENSP00000369843
  • ENSG00000120915
  • ENST00000521400
  • ENSP00000430269
  • ENST00000521780
  • ENSP00000430302

Symbol
  • CEH
  • SEH
  • ABHD20
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.97
transcription factor perturbation
0.96
gene perturbation
0.95
protein domain
0.92
chemical
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 317.82   (req: < 5)
Gene RIFs: 75   (req: <= 3)
Antibodies: 368   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 317.82   (req: >= 5)
Gene RIFs: 75   (req: > 3)
Antibodies: 368   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 26
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1364
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 6
Active Ligands (1364)
1 – 10 of 1364
CHEMBL215387
chemical structure image
CHEMBL242459
chemical structure image
CHEMBL560590
chemical structure image
CHEMBL214943
chemical structure image
dual sEH/FAAH inhibitor 11
chemical structure image
CHEMBL436774
chemical structure image
CHEMBL242255,CHEMBL516415
chemical structure image
CHEMBL217758
chemical structure image
CHEMBL3263303
chemical structure image
Protein Data Bank (100)
1 – 5 of 100
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (53)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Biosynthesis of DHA-derived SPMs
Reactome
Biosynthesis of maresins
Reactome
Biosynthesis of specialized proresolving mediators (SPMs)
Reactome
Fatty acid metabolism
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Biosynthesis of DHA-derived SPMs
Biosynthesis of maresins
Biosynthesis of specialized proresolving mediators (SPMs)
Fatty acid metabolism
Gene Ontology Terms (30)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (137)
1 – 10 of 137
CYP2J2
Tchem
Novelty: 0.00634057
Score: 0.967
Data Source: STRINGDB
AGXT
Tbio
Family: Enzyme
Novelty: 0.00130886
Score: 0.953
Data Source: STRINGDB
CYP2C9
Tchem
Novelty: 0.00054291
Score: 0.951
Data Source: STRINGDB
CYP2C8
Tchem
Novelty: 0.00265032
Score: 0.949
Data Source: STRINGDB
GSTK1
Tchem
Family: Enzyme
Novelty: 0.06692867
Score: 0.947
Data Source: STRINGDB
CAT
Tbio
Family: Enzyme
Novelty: 0.00022628
Score: 0.944
Data Source: STRINGDB
SCP2
Tchem
Novelty: 0.00215179
Score: 0.944
Data Source: STRINGDB
CYP2B6
Tchem
Novelty: 0.00018723
Score: 0.934
Data Source: STRINGDB
HAO1
Tchem
Family: Enzyme
Novelty: 0.00079931
Score: 0.928
Data Source: STRINGDB
ACOX1
Tbio
Family: Enzyme
Novelty: 0.00626693
Score: 0.927
Data Source: STRINGDB
Publication Statistics
PubMed Score  317.82

PubMed score by year
PubTator Score  421.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEEN
1-70
CRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLM
70-140
CELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTAL
140-210
KELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPA
210-280
LAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPE
280-350
RVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
350-420
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALM
420-490
VTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM
490-555
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM