You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CYP2C18
Cytochrome P450 2C18

Protein Summary
Description
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum but its specific substrate has not yet been determined. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. An additional gene, CYP2C17, was once thought to exist; however, CYP2C17 is now considered an artefact based on a chimera of CYP2C18 and CYP2C19. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000285979
  • ENSP00000285979
  • ENSG00000108242
  • ENST00000339022
  • ENSP00000341293

Symbol
  • CPCI
  • CYP2C
  • CYP2C17
  • P450IIC17
  • P450-6B/29C
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
0.95
gene perturbation
0.82
cell type or tissue
0.78
molecular function
0.73
microRNA
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.76   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 95   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.76   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 95   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Metabolism
Reactome
Phase I - Functionalization of compounds
Reactome
Xenobiotics
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cytochrome P450 - arranged by substrate type
Metabolism
Phase I - Functionalization of compounds
Xenobiotics
Gene Ontology Terms (17)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (81)
1 – 10 of 81
CYP2C9
Tchem
Novelty: 0.00054291
p_int: 1
Score: 0.571
Data Source: BioPlex,STRINGDB
TMEM260
Tdark
Novelty: 0.63157895
p_int: 0.999999708
p_ni: 2.2e-8
p_wrong: 2.7e-7
Score: 0.269
Data Source: BioPlex,STRINGDB
SLC7A2
Tbio
Family: Transporter
Novelty: 0.02899779
p_int: 0.956366317
p_ni: 0.043621284
p_wrong: 0.000012399
Score: 0.204
Data Source: BioPlex,STRINGDB
EPHX1
Tchem
Family: Enzyme
Novelty: 0.00210581
Score: 0.951
Data Source: STRINGDB
CYP4A11
Tbio
Novelty: 0.01325821
Score: 0.941
Data Source: STRINGDB
CYP1A1
Tchem
Novelty: 0.00028982
Score: 0.924
Data Source: STRINGDB
AOX1
Tbio
Family: Enzyme
Novelty: 0.00323057
Score: 0.908
Data Source: STRINGDB
UGT1A1
Tchem
Family: Enzyme
Novelty: 0.00173218
Score: 0.844
Data Source: STRINGDB
UGT1A8
Tbio
Family: Enzyme
Novelty: 0.00173655
Score: 0.83
Data Source: STRINGDB
CYP3A4
Tclin
Family: Enzyme
Novelty: 0.00020884
Score: 0.828
Data Source: STRINGDB
Publication Statistics
PubMed Score  270.76

PubMed score by year
PubTator Score  119.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFG
1-70
LKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRS
70-140
IEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSS
140-210
PWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQS
210-280
EFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDA
280-350
VVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK
350-420
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
420-490
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV