You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD70
CD70 antigen

Protein Summary
Description
Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000245903
  • ENSP00000245903
  • ENSG00000125726
  • ENST00000423145
  • ENSP00000395294

Symbol
  • CD27L
  • CD27LG
  • TNFSF7
  • CD27L
  • LPFS3
  • CD27-L
  • CD27LG
  • TNFSF7
  • TNLG8A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.84
cell type or tissue
0.81
biological term
0.66
disease
0.63
tissue
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 235.51   (req: < 5)
Gene RIFs: 55   (req: <= 3)
Antibodies: 759   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 235.51   (req: >= 5)
Gene RIFs: 55   (req: > 3)
Antibodies: 759   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNFR2 non-canonical NF-kB pathway
Reactome
TNFs bind their physiological receptors
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Protein-Protein Interactions (150)
1 – 10 of 150
KDM8
Tbio
Family: Epigenetic
Novelty: 0.01809928
p_int: 0.999997964
p_ni: 0.000001363
p_wrong: 6.73e-7
Data Source: BioPlex
TNFRSF13B
Tbio
Novelty: 0.00443808
p_int: 0.999996663
p_ni: 0.00000151
p_wrong: 0.000001827
Score: 0.459
Data Source: BioPlex,STRINGDB
CD27
Tbio
Novelty: 0.00109406
p_int: 0.999982532
p_ni: 0.00001164
p_wrong: 0.000005827
Score: 0.994
Data Source: BioPlex,Reactome,STRINGDB
SEC14L1
Tbio
Novelty: 0.17045632
p_int: 0.999965226
p_ni: 0.000028311
p_wrong: 0.000006463
Data Source: BioPlex
TNFRSF17
Tbio
Novelty: 0.00587499
p_int: 0.999956133
p_ni: 0.000012136
p_wrong: 0.000031731
Score: 0.353
Data Source: BioPlex,STRINGDB
TAMM41
Tbio
Family: Enzyme
Novelty: 0.08219178
p_int: 0.999942466
p_ni: 0.000057533
p_wrong: 2e-9
Data Source: BioPlex
FANCG
Tbio
Novelty: 0.00411649
p_int: 0.999868
p_ni: 0.000127717
p_wrong: 0.000004283
Data Source: BioPlex
NR2C2
Tchem
Family: NR
Novelty: 0.00578325
p_int: 0.999825023
p_ni: 0.000001318
p_wrong: 0.000173659
Score: 0.177
Data Source: BioPlex,STRINGDB
PDXDC1
Tdark
Family: Enzyme
Novelty: 0.43701506
p_int: 0.999818703
p_ni: 0.000181297
Data Source: BioPlex
UTP20
Tbio
Novelty: 0.03742259
p_int: 0.999723741
p_ni: 0.000276259
Data Source: BioPlex
Publication Statistics
PubMed Score  235.51

PubMed score by year
PubTator Score  156.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD
1-70
PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI
70-140
SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
140-193
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP