Protein Summary
Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
- ENST00000245903
- ENSP00000245903
- ENSG00000125726
- ENST00000423145
- ENSP00000395294
- CD27L
- CD27LG
- TNFSF7
- CD27L
- LPFS3
- CD27-L
- CD27LG
- TNFSF7
- TNLG8A
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
gene perturbation | 0.84 | ||
cell type or tissue | 0.81 | ||
biological term | 0.66 | ||
disease | 0.63 | ||
tissue | 0.61 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 235.51 (req: < 5)
Gene RIFs: 55 (req: <= 3)
Antibodies: 759 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 235.51 (req: >= 5)
Gene RIFs: 55 (req: > 3)
Antibodies: 759 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 10
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (5)
Reactome (4)
KEGG (1)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cytokine Signaling in Immune system | ||||
Reactome | Immune System | ||||
Reactome | TNFR2 non-canonical NF-kB pathway | ||||
Reactome | TNFs bind their physiological receptors | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cytokine Signaling in Immune system | ||||
Immune System | ||||
TNFR2 non-canonical NF-kB pathway | ||||
TNFs bind their physiological receptors | ||||
Gene Ontology Terms (13)
Functions (4)
Components (3)
Processes (6)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Physical Interaction (IPI) | BHF-UCL | |||
Traceable Author Statement (TAS) | ProtInc | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (150)
1 – 10 of 150
KDM8
Family: Epigenetic
Novelty: 0.01809928
p_int: 0.999997964
p_ni: 0.000001363
p_wrong: 6.73e-7
Data Source: BioPlex
TNFRSF13B
Novelty: 0.00443808
p_int: 0.999996663
p_ni: 0.00000151
p_wrong: 0.000001827
Score: 0.459
Data Source: BioPlex,STRINGDB
CD27
Novelty: 0.00109406
p_int: 0.999982532
p_ni: 0.00001164
p_wrong: 0.000005827
Score: 0.994
Data Source: BioPlex,Reactome,STRINGDB
SEC14L1
Novelty: 0.17045632
p_int: 0.999965226
p_ni: 0.000028311
p_wrong: 0.000006463
Data Source: BioPlex
TNFRSF17
Novelty: 0.00587499
p_int: 0.999956133
p_ni: 0.000012136
p_wrong: 0.000031731
Score: 0.353
Data Source: BioPlex,STRINGDB
TAMM41
Family: Enzyme
Novelty: 0.08219178
p_int: 0.999942466
p_ni: 0.000057533
p_wrong: 2e-9
Data Source: BioPlex
FANCG
Novelty: 0.00411649
p_int: 0.999868
p_ni: 0.000127717
p_wrong: 0.000004283
Data Source: BioPlex
NR2C2
Family: NR
Novelty: 0.00578325
p_int: 0.999825023
p_ni: 0.000001318
p_wrong: 0.000173659
Score: 0.177
Data Source: BioPlex,STRINGDB
PDXDC1
Family: Enzyme
Novelty: 0.43701506
p_int: 0.999818703
p_ni: 0.000181297
Data Source: BioPlex
UTP20
Novelty: 0.03742259
p_int: 0.999723741
p_ni: 0.000276259
Data Source: BioPlex
Publication Statistics
PubMed Score 235.51
PubMed score by year
PubTator Score 156.36
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD
1-70
PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI
70-140
SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
140-193
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Find similar targets by: