You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRNA3
Neuronal acetylcholine receptor subunit alpha-3

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000326828
  • ENSP00000315602
  • ENSG00000080644
  • ENST00000348639
  • ENSP00000267951
  • ENST00000559658
  • ENSP00000452896

Symbol
  • NACHRA3
  • LNCR2
  • PAOD2
  • NACHRA3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
trait
0.86
protein domain
0.85
biological term
0.83
microRNA
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.69   (req: < 5)
Gene RIFs: 140   (req: <= 3)
Antibodies: 276   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.69   (req: >= 5)
Gene RIFs: 140   (req: > 3)
Antibodies: 276   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 11
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (49)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly calcium permeable nicotinic acetylcholine receptors
Reactome
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Reactome
Highly sodium permeable acetylcholine nicotinic receptors
Reactome
Neuronal System
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly calcium permeable nicotinic acetylcholine receptors
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Highly sodium permeable acetylcholine nicotinic receptors
Neuronal System
Protein-Protein Interactions (91)
1 – 10 of 91
GLT8D2
Tbio
Family: Enzyme
Novelty: 1.33333333
p_int: 0.999579184
p_ni: 0.000420812
p_wrong: 4e-9
Data Source: BioPlex
TMEM231
Tbio
Novelty: 0.22861101
p_int: 0.997455186
p_ni: 0.002544808
p_wrong: 7e-9
Data Source: BioPlex
EDA
Tbio
Novelty: 0.00076336
p_int: 0.996599603
p_ni: 0.003400366
p_wrong: 3.1e-8
Data Source: BioPlex
GLRB
Tclin
Family: IC
Novelty: 0.00335964
p_int: 0.992420528
p_ni: 0.007230647
p_wrong: 0.000348825
Score: 0.202
Data Source: BioPlex,STRINGDB
TMEM219
Tdark
Novelty: 0.4851752
p_int: 0.992382475
p_ni: 0.007553667
p_wrong: 0.000063857
Data Source: BioPlex
LEMD2
Tdark
Novelty: 0.1754386
p_int: 0.990450314
p_ni: 0.009549686
Data Source: BioPlex
TMEM143
Tdark
Novelty: 3
p_int: 0.989418744
p_ni: 0.010544919
p_wrong: 0.000036336
Score: 0.169
Data Source: BioPlex,STRINGDB
CNNM1
Tdark
Novelty: 0.16670044
p_int: 0.984189905
p_ni: 0.015809768
p_wrong: 3.26e-7
Score: 0.285
Data Source: BioPlex,STRINGDB
TPST2
Tbio
Family: Enzyme
Novelty: 0.03075981
p_int: 0.982612574
p_ni: 0.016853458
p_wrong: 0.000533968
Score: 0.222
Data Source: BioPlex,STRINGDB
ENTPD7
Tbio
Family: Enzyme
Novelty: 0.2117736
p_int: 0.978078545
p_ni: 0.020100137
p_wrong: 0.001821318
Data Source: BioPlex
Publication Statistics
PubMed Score  104.69

PubMed score by year
PubTator Score  98.54

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQ
1-70
LVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL
70-140
LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAII
140-210
KAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVL
210-280
LSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLL
280-350
PRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
350-420
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILG
420-490
TAGLFLQPLMAREDA
490-505
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA