You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OTX2
Homeobox protein OTX2

Protein Summary
Description
Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine. [provided by RefSeq, Jul 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000339475
  • ENSP00000343819
  • ENSG00000165588
  • ENST00000408990
  • ENSP00000386185
  • ENST00000555006
  • ENSP00000452336

Symbol
  • CPHD6
  • MCOPS5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.88
protein domain
0.85
phenotype
0.79
biological process
0.71
gene perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 338.42   (req: < 5)
Gene RIFs: 69   (req: <= 3)
Antibodies: 368   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 338.42   (req: >= 5)
Gene RIFs: 69   (req: > 3)
Antibodies: 368   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
TP53 Network
WikiPathways
Dopaminergic Neurogenesis
WikiPathways
Endoderm Differentiation
Name
Explore in Pharos
Explore in Source
TP53 Network
Dopaminergic Neurogenesis
Endoderm Differentiation
Gene Ontology Terms (19)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (204)
1 – 10 of 204
FGF8
Tbio
Novelty: 0.00182042
Score: 0.88
Data Source: STRINGDB
FOXA2
Tbio
Family: TF
Novelty: 0.00339972
Score: 0.864
Data Source: STRINGDB
SIX3
Tbio
Family: TF
Novelty: 0.00299273
Score: 0.855
Data Source: STRINGDB
SOX2
Tbio
Family: TF
Novelty: 0.00050367
Score: 0.851
Data Source: STRINGDB
WNT1
Tbio
Novelty: 0.0015436
Score: 0.847
Data Source: STRINGDB
SIX6
Tbio
Family: TF
Novelty: 0.00566598
Score: 0.834
Data Source: STRINGDB
PAX2
Tbio
Family: TF
Novelty: 0.00184914
Score: 0.815
Data Source: STRINGDB
ISL1
Tbio
Family: TF
Novelty: 0.00222272
Score: 0.802
Data Source: STRINGDB
POU5F1
Tbio
Family: TF
Novelty: 0.000425
Score: 0.786
Data Source: STRINGDB
FOXG1
Tbio
Family: TF
Novelty: 0.00207724
Score: 0.775
Data Source: STRINGDB
Publication Statistics
PubMed Score  338.42

PubMed score by year
PubTator Score  151.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREE
1-70
VALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVP
70-140
TIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHH
140-210
QLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQ
210-280
TSSWKFQVL
280-289
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL