You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GK
Glycerol kinase

Protein Summary
Description
Key enzyme in the regulation of glycerol uptake and metabolism. The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378943
  • ENSP00000368226
  • ENSG00000198814
  • ENST00000378945
  • ENSP00000368228
  • ENST00000378946
  • ENSP00000368229
  • ENST00000427190
  • ENSP00000401720

Symbol
  • GK1
  • GKD
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
cellular component
0.77
PubMedID
0.76
gene perturbation
0.75
transcription factor
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 112.85   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 304   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 112.85   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 304   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Triglyceride biosynthesis
Reactome
Triglyceride metabolism
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
Triglyceride biosynthesis
Triglyceride metabolism
Gene Ontology Terms (13)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (141)
1 – 10 of 141
GK3P
Tdark
Family: Kinase
p_int: 1
Data Source: BioPlex
GK2
Tbio
Family: Kinase
Novelty: 0.13888889
p_int: 0.999995109
p_ni: 3e-9
p_wrong: 0.000004888
Score: 0.807
Data Source: BioPlex,STRINGDB
GHITM
Tbio
Novelty: 0.00422208
p_int: 0.999673331
p_ni: 0.000326669
Data Source: BioPlex
SLC5A8
Tchem
Family: Transporter
Novelty: 0.01112418
p_int: 0.985291546
p_ni: 0.014708453
Data Source: BioPlex
SCGB1D2
Tbio
Novelty: 0.017009
p_int: 0.979065681
p_ni: 0.015259927
p_wrong: 0.005674392
Data Source: BioPlex
UBP1
Tbio
Family: TF
Novelty: 0.01787931
p_int: 0.978727917
p_ni: 0.019273914
p_wrong: 0.001998169
Data Source: BioPlex
HBB
Tbio
Novelty: 0.00039916
p_int: 0.976949427
p_ni: 0.023050573
Data Source: BioPlex
DR1
Tbio
Novelty: 0.00298399
p_int: 0.974816626
p_ni: 0.025183374
Data Source: BioPlex
CMTM8
Tbio
Novelty: 0.13251301
p_int: 0.970206158
p_ni: 0.029793842
Data Source: BioPlex
APLNR
Tchem
Family: GPCR
Novelty: 0.001441
p_int: 0.964849312
p_ni: 0.035150688
Data Source: BioPlex
Publication Statistics
PubMed Score  112.85

PubMed score by year
PubTator Score  71.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK
1-70
TCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSK
70-140
TGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI
140-210
HSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQ
210-280
AKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEE
280-350
IEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
350-420
CGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTM
420-490
ERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP
490-559
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP