You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FMO3
Dimethylaniline monooxygenase [N-oxide-forming] 3

Protein Summary
Description
Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds (PubMed:9224773). Flavin-containing monooxygenases (FMO) are an important class of drug-metabolizing enzymes that catalyze the NADPH-dependent oxygenation of various nitrogen-,sulfur-, and phosphorous-containing xenobiotics such as therapeutic drugs, dietary compounds, pesticides, and other foreign compounds. The human FMO gene family is composed of 5 genes and multiple pseudogenes. FMO members have distinct developmental- and tissue-specific expression patterns. The expression of this FMO3 gene, the major FMO expressed in adult liver, can vary up to 20-fold between individuals. This inter-individual variation in FMO3 expression le ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367755
  • ENSP00000356729
  • ENSG00000007933

Symbol
  • TMAU
  • FMOII
  • dJ127D3.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.84
molecular function
0.79
cell type or tissue
0.7
biological term
0.62
cellular component
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 155.96   (req: < 5)
Gene RIFs: 64   (req: <= 3)
Antibodies: 320   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 155.96   (req: >= 5)
Gene RIFs: 64   (req: > 3)
Antibodies: 320   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Defective FMO3 causes Trimethylaminuria (TMAU)
Reactome
Disease
Reactome
Diseases of metabolism
Reactome
FMO oxidises nucleophiles
Name
Explore in Pharos
Explore in Source
Biological oxidations
Defective FMO3 causes Trimethylaminuria (TMAU)
Disease
Diseases of metabolism
FMO oxidises nucleophiles
Gene Ontology Terms (10)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (49)
1 – 10 of 49
NRAS
Tchem
Family: Enzyme
Novelty: 0.00085585
p_int: 0.873390509
p_ni: 0.126608391
p_wrong: 0.0000011
Data Source: BioPlex
CYP3A4
Tclin
Family: Enzyme
Novelty: 0.00020884
Score: 0.967
Data Source: STRINGDB
CYP2D6
Tclin
Family: Enzyme
Novelty: 0.00028482
Score: 0.961
Data Source: STRINGDB
CYP2C9
Tchem
Novelty: 0.00054291
Score: 0.954
Data Source: STRINGDB
DMGDH
Tbio
Family: Enzyme
Novelty: 0.0423188
Score: 0.811
Data Source: STRINGDB
DECR1
Tbio
Family: Enzyme
Novelty: 0.01886929
Score: 0.731
Data Source: STRINGDB
NR1H4
Tclin
Family: NR
Novelty: 0.00083346
Score: 0.666
Data Source: STRINGDB
CYP2A6
Tchem
Novelty: 0.00137727
Score: 0.641
Data Source: STRINGDB
CYP1A2
Tchem
Novelty: 0.00045419
Score: 0.628
Data Source: STRINGDB
CYP2B6
Tchem
Novelty: 0.00018723
Score: 0.626
Data Source: STRINGDB
Publication Statistics
PubMed Score  155.96

PubMed score by year
PubTator Score  206.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFP
1-70
DFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVF
70-140
DAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQV
140-210
MISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRK
210-280
EPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEI
280-350
ILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
350-420
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQW
420-490
DRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
490-532
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWFGKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT