You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRNB4
Neuronal acetylcholine receptor subunit beta-4

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is found within a conserved gene cluster and encodes one of the beta subunits of the nicotinic acetylcholine receptor (nAChRs) superfamily which form ligand-gated ion channels with a central pore that forms a cation channel. Neuronal nAChRs are pentameric structures that can be either homomeric or heteromeric, with heteromeric structures containing both alpha and beta subunits. Each subunit contains an extracellular amino terminus and four transmembrane domains. Nicotine is one of the agonists that binds to the receptor. Variants in this gene have been associated with nicotine dependence and lung cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261751
  • ENSP00000261751
  • ENSG00000117971
  • ENST00000412074
  • ENSP00000416386
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
molecular function
0.84
chemical
0.77
gene perturbation
0.75
biological term
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.28   (req: < 5)
Gene RIFs: 76   (req: <= 3)
Antibodies: 160   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.28   (req: >= 5)
Gene RIFs: 76   (req: > 3)
Antibodies: 160   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (75)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly calcium permeable nicotinic acetylcholine receptors
Reactome
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Reactome
Highly sodium permeable acetylcholine nicotinic receptors
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly calcium permeable nicotinic acetylcholine receptors
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Highly sodium permeable acetylcholine nicotinic receptors
Immune System
Gene Ontology Terms (35)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
DFLAT
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (230)
1 – 10 of 230
UBA52
Tbio
Novelty: 0.01006012
p_int: 0.999999992
p_ni: 6e-9
p_wrong: 2e-9
Data Source: BioPlex
GABRB3
Tclin
Family: IC
Novelty: 0.00713058
p_int: 0.999871347
p_ni: 0.000121053
p_wrong: 0.0000076
Data Source: BioPlex
ICAM4
Tbio
Novelty: 0.03417897
p_int: 0.999843933
p_ni: 0.000155872
p_wrong: 1.95e-7
Data Source: BioPlex
GLT8D2
Tbio
Family: Enzyme
Novelty: 1.33333333
p_int: 0.999564623
p_ni: 0.00043236
p_wrong: 0.000003017
Data Source: BioPlex
TAPBP
Tbio
Novelty: 0.00308518
p_int: 0.999501968
p_ni: 0.000222773
p_wrong: 0.000275259
Data Source: BioPlex
PIGB
Tbio
Family: Enzyme
Novelty: 0.04150533
p_int: 0.999501968
p_ni: 0.000222773
p_wrong: 0.000275259
Data Source: BioPlex
ATP13A3
Tbio
Family: Transporter
Novelty: 0.34759358
p_int: 0.99906835
p_ni: 0.00093165
Score: 0.281
Data Source: BioPlex,STRINGDB
UGT3A2
Tbio
Family: Enzyme
Novelty: 1.37837838
p_int: 0.99894042
p_ni: 0.000431468
p_wrong: 0.000628113
Data Source: BioPlex
MIB2
Tbio
Family: Enzyme
Novelty: 0.0194052
p_int: 0.998788785
p_ni: 0.001205532
p_wrong: 0.000005683
Data Source: BioPlex
RHBDD3
Tbio
Novelty: 0.01057713
p_int: 0.997287656
p_ni: 0.002712201
p_wrong: 1.43e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  38.28

PubMed score by year
PubTator Score  36.06

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNE
1-70
REQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGS
70-140
VLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEWDIVALPGRR
140-210
TVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLL
210-280
ISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRP
280-350
GPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
350-420
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASE
420-490
GPYAAQRD
490-498
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASEGPYAAQRD