You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
SSTR1
Somatostatin receptor type 1

Protein Summary
Description
Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and Na(+)/H(+) exchanger via pertussis toxin insensitive G proteins. Somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of many hormones and other secretory proteins. Somatostatin has two active forms of 14 and 28 amino acids. The biological effects of somatostatins are mediated by a family of G-protein coupled somatostatin receptors that are expressed in a tissue-specific manner. The protein encoded by this gene is a member of the superfamily of somatostatin receptors having seven transmembrane segments. Somatostatin receptors form homodimers and heterodimers with other members of the superfamily as well as with other G-protein c ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267377
  • ENSP00000267377
  • ENSG00000139874

Symbol
  • SS1R
  • SS1-R
  • SRIF-2
  • SS-1-R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.84
ligand (chemical)
0.8
cell type or tissue
0.61
PubMedID
0.6
biological process
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 293.09   (req: < 5)
Gene RIFs: 36   (req: <= 3)
Antibodies: 400   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 293.09   (req: >= 5)
Gene RIFs: 36   (req: > 3)
Antibodies: 400   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 66
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Pathways (14)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Protein-Protein Interactions (278)
1 – 10 of 278
SST
Tbio
Novelty: 0.0000732
Score: 0.995
Data Source: STRINGDB
CORT
Tbio
Novelty: 0.0034818
Score: 0.97
Data Source: STRINGDB
POMC
Tbio
Novelty: 0.00002654
Score: 0.955
Data Source: STRINGDB
NPB
Tdark
Novelty: 0.00254878
Score: 0.943
Data Source: STRINGDB
NPY
Tbio
Novelty: 0.00014761
Score: 0.941
Data Source: STRINGDB
PPY
Tbio
Novelty: 0.00056678
Score: 0.94
Data Source: STRINGDB
SSTR5
Tclin
Family: GPCR
Novelty: 0.00312149
Score: 0.94
Data Source: STRINGDB
GNAI1
Tbio
Novelty: 0.12575547
Score: 0.939
Data Source: STRINGDB
NPW
Tbio
Novelty: 0.01251552
Score: 0.936
Data Source: STRINGDB
GAL
Tbio
Novelty: 0.00057698
Score: 0.935
Data Source: STRINGDB
Publication Statistics
PubMed Score  293.09

PubMed score by year
PubTator Score  143.87

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL
1-70
VGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVN
70-140
MFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNM
140-210
LMPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVF
210-280
VICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEP
280-350
VDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL
350-391
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL