You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALDH1B1
Aldehyde dehydrogenase X, mitochondrial

Protein Summary
Description
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377698
  • ENSP00000366927
  • ENSG00000137124

Symbol
  • ALDH5
  • ALDHX
  • ALDH5
  • ALDHX
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.98
protein domain
0.85
histone modification site profile
0.82
pathway
0.75
PubMedID
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 47.85   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 258   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 47.85   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 258   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (26)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Ethanol oxidation
Reactome
Metabolism
Reactome
Phase I - Functionalization of compounds
Name
Explore in Pharos
Explore in Source
Biological oxidations
Ethanol oxidation
Metabolism
Phase I - Functionalization of compounds
Protein-Protein Interactions (97)
1 – 10 of 97
FEM1B
Tbio
Novelty: 0.07122869
p_int: 0.989282236
p_ni: 0.010717761
p_wrong: 4e-9
Score: 0.249
Data Source: BioPlex,STRINGDB
DHRS4
Tbio
Family: Enzyme
Novelty: 0.02859799
p_int: 0.947545192
p_ni: 0.05245437
p_wrong: 4.38e-7
Score: 0.349
Data Source: BioPlex,STRINGDB
SUFU
Tbio
Novelty: 0.00485324
p_int: 0.893246933
p_ni: 0.106752248
p_wrong: 8.19e-7
Score: 0.226
Data Source: BioPlex,STRINGDB
HIBADH
Tbio
Family: Enzyme
Novelty: 0.05644529
Score: 0.956
Data Source: STRINGDB
ABAT
Tclin
Family: Enzyme
Novelty: 0.00944717
Score: 0.942
Data Source: STRINGDB
AKR1A1
Tchem
Family: Enzyme
Novelty: 0.00656392
Score: 0.933
Data Source: STRINGDB
ALDH6A1
Tbio
Family: Enzyme
Novelty: 0.05651741
Score: 0.931
Data Source: STRINGDB
DERA
Tbio
Family: Enzyme
Novelty: 0.00609386
Score: 0.927
Data Source: STRINGDB
AOC1
Tchem
Family: Enzyme
Novelty: 0.00142124
Score: 0.925
Data Source: STRINGDB
BBOX1
Tchem
Family: Enzyme
Novelty: 0.00263045
Score: 0.923
Data Source: STRINGDB
Publication Statistics
PubMed Score  47.85

PubMed score by year
PubTator Score  23.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAE
1-70
GDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLD
70-140
EVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKV
140-210
AEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLK
210-280
RVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN
280-350
PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
350-420
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGN
420-490
GRELGEDGLKAYTEVKTVTIKVPQKNS
490-517
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS