You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GNA15
Guanine nucleotide-binding protein subunit alpha-15

Protein Summary
Description
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262958
  • ENSP00000262958
  • ENSG00000060558

Symbol
  • GNA16
  • GNA16
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
gene perturbation
0.79
cell type or tissue
0.7
pathway
0.58
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 474.59   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 228   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 474.59   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 228   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (54)
ADP signalling through P2Y purinoceptor 1 (R-HSA-418592)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ADP signalling through P2Y purinoceptor 1
Reactome
Acetylcholine regulates insulin secretion
Reactome
Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
Reactome
Free fatty acids regulate insulin secretion
Reactome
G alpha (q) signalling events
Name
Explore in Pharos
Explore in Source
ADP signalling through P2Y purinoceptor 1
Acetylcholine regulates insulin secretion
Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
Free fatty acids regulate insulin secretion
G alpha (q) signalling events
Gene Ontology Terms (14)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (285)
1 – 10 of 285
WDCP
Tdark
Novelty: 0.47058824
p_int: 0.997997341
p_ni: 0.002002659
Score: 0.187
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.973989968
p_ni: 0.026010032
Score: 0.323
Data Source: BioPlex,STRINGDB
APPBP2
Tdark
Novelty: 0.26800177
p_int: 0.96236103
p_ni: 0.03763828
p_wrong: 6.9e-7
Score: 0.189
Data Source: BioPlex,STRINGDB
FECH
Tbio
Family: Enzyme
Novelty: 0.00199177
p_int: 0.861351616
p_ni: 0.138648384
Score: 0.206
Data Source: BioPlex,STRINGDB
GNB3
Tbio
Novelty: 0.0043523
Score: 0.983
Data Source: STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.976
Data Source: Reactome,STRINGDB
GNB2
Tbio
Novelty: 0.20536996
Score: 0.973
Data Source: STRINGDB
GNB4
Tbio
Novelty: 0.1530232
Score: 0.97
Data Source: STRINGDB
GNB5
Tbio
Novelty: 0.01077999
Score: 0.966
Data Source: STRINGDB
GNGT1
Tbio
Novelty: 0.03653174
Score: 0.965
Data Source: STRINGDB
Publication Statistics
PubMed Score  474.59

PubMed score by year
PubTator Score  63.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGY
1-70
SEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWR
70-140
DAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVG
140-210
GQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTD
210-280
ILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ
280-350
NIRKVFKDVRDSVLARYLDEINLL
350-374
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLARYLDEINLL