You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PKLR
Pyruvate kinase PKLR

Protein Summary
Description
Plays a key role in glycolysis. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000342741
  • ENSP00000339933
  • ENSG00000143627
  • ENST00000392414
  • ENSP00000376214
  • ENST00000571194
  • ENSP00000461487
  • ENSG00000262785
  • ENST00000572740
  • ENSP00000459921

Symbol
  • PK1
  • PKL
  • PK1
  • PKL
  • RPK
  • PKRL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
molecular function
0.95
biological process
0.94
disease perturbation
0.79
disease
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 237.93   (req: < 5)
Gene RIFs: 54   (req: <= 3)
Antibodies: 487   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 237.93   (req: >= 5)
Gene RIFs: 54   (req: > 3)
Antibodies: 487   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
ChREBP activates metabolic gene expression (R-HSA-163765)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ChREBP activates metabolic gene expression
Reactome
Developmental Biology
Reactome
Glucose metabolism
Reactome
Glycolysis
Reactome
Integration of energy metabolism
Name
Explore in Pharos
Explore in Source
ChREBP activates metabolic gene expression
Developmental Biology
Glucose metabolism
Glycolysis
Integration of energy metabolism
Gene Ontology Terms (18)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (328)
1 – 10 of 328
MRAS
Tbio
Family: Enzyme
Novelty: 0.00292294
p_int: 0.999817905
p_ni: 0.000182083
p_wrong: 1.3e-8
Score: 0.686
Data Source: BioPlex,STRINGDB
NT5DC1
Tdark
Family: Enzyme
Novelty: 0.6
p_int: 0.99957282
p_ni: 0.000347294
p_wrong: 0.000079885
Score: 0.537
Data Source: BioPlex,STRINGDB
CYP4B1
Tbio
Novelty: 0.01439455
p_int: 0.998874876
p_ni: 0.001125123
p_wrong: 1e-9
Score: 0.699
Data Source: BioPlex,STRINGDB
ENO4
Tbio
Family: Enzyme
Novelty: 0.07474304
Score: 0.987
Data Source: STRINGDB
ENO3
Tbio
Family: Enzyme
Novelty: 0.00432053
Score: 0.985
Data Source: STRINGDB
ENO1
Tchem
Family: Enzyme
Novelty: 0.00138287
Score: 0.984
Data Source: STRINGDB
GPI
Tbio
Family: Enzyme
Novelty: 0.00073017
Score: 0.983
Data Source: STRINGDB
ENO2
Tbio
Family: Enzyme
Novelty: 0.00021254
Score: 0.98
Data Source: STRINGDB
PC
Tbio
Family: Enzyme
Novelty: 0.00322567
Score: 0.979
Data Source: STRINGDB
PCK1
Tbio
Family: Kinase
Novelty: 0.00439852
Score: 0.966
Data Source: STRINGDB
Publication Statistics
PubMed Score  237.93

PubMed score by year
PubTator Score  220.33

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFL
1-70
EHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVREAVES
70-140
FAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRV
140-210
VPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGV
210-280
DIVFASFVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVF
280-350
LAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
350-420
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPR
420-490
AAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRP
490-560
GSGYTNIMRVLSIS
560-574
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS