You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CDC25C
M-phase inducer phosphatase 3

Protein Summary
Description
Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity. This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000323760
  • ENSP00000321656
  • ENSG00000158402
  • ENST00000348983
  • ENSP00000345205
  • ENST00000415130
  • ENSP00000392631
  • ENST00000513970
  • ENSP00000424795
  • ENST00000514555
  • ENSP00000425470

Symbol
  • CDC25
  • PPP1R60
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase
1
hub protein
0.98
transcription factor perturbation
0.91
biological term
0.85
chemical
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 320.17   (req: < 5)
Gene RIFs: 81   (req: <= 3)
Antibodies: 1007   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 320.17   (req: >= 5)
Gene RIFs: 81   (req: > 3)
Antibodies: 1007   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 9
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (42)
Activation of ATR in response to replication stress (R-HSA-176187)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 25
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of ATR in response to replication stress
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
Cell Cycle, Mitotic
Reactome
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
Name
Explore in Pharos
Explore in Source
Activation of ATR in response to replication stress
Cell Cycle
Cell Cycle Checkpoints
Cell Cycle, Mitotic
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
Protein-Protein Interactions (302)
1 – 10 of 302
SUFU
Tbio
Novelty: 0.00485324
p_int: 0.999993159
p_ni: 0.000006841
Score: 0.269
Data Source: BioPlex,STRINGDB
SHC1
Tchem
Novelty: 0.00113167
p_int: 0.981733651
p_ni: 0.018266346
p_wrong: 3e-9
Score: 0.346
Data Source: BioPlex,STRINGDB
CDK1
Tchem
Family: Kinase
Novelty: 0.00049984
Score: 0.999
Data Source: Reactome,STRINGDB
CCNB1
Tchem
Novelty: 0.00068627
Score: 0.999
Data Source: Reactome,STRINGDB
CHEK1
Tchem
Family: Kinase
Novelty: 0.00078041
Score: 0.998
Data Source: Reactome,STRINGDB
CHEK2
Tchem
Family: Kinase
Novelty: 0.00089751
Score: 0.998
Data Source: Reactome,STRINGDB
PLK1
Tchem
Family: Kinase
Novelty: 0.00071387
Score: 0.997
Data Source: Reactome,STRINGDB
CCNA2
Tchem
Novelty: 0.00061948
Score: 0.995
Data Source: STRINGDB
YWHAZ
Tbio
Novelty: 0.00235606
Score: 0.992
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.992
Data Source: STRINGDB
Publication Statistics
PubMed Score  320.17

PubMed score by year
PubTator Score  581.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKR
1-70
CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK
70-140
RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG
140-210
LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG
210-280
HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ
280-350
EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
350-420
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
420-473
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP