You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FCER1G
High affinity immunoglobulin epsilon receptor subunit gamma

Protein Summary
Description
Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. May function cooperatively with other activating receptors. Functionally linked to integrin b ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000289902
  • ENSP00000289902
  • ENSG00000158869

Symbol
  • FCRG
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
gene perturbation
0.76
kinase perturbation
0.76
tissue sample
0.64
phenotype
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 96.52   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 149   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 96.52   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 149   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 44
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (28)
C-type lectin receptors (CLRs) (R-HSA-5621481)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
C-type lectin receptors (CLRs)
Reactome
Cell surface interactions at the vascular wall
Reactome
Dectin-2 family
Reactome
Fc epsilon receptor (FCERI) signaling
Reactome
GPVI-mediated activation cascade
Name
Explore in Pharos
Explore in Source
C-type lectin receptors (CLRs)
Cell surface interactions at the vascular wall
Dectin-2 family
Fc epsilon receptor (FCERI) signaling
GPVI-mediated activation cascade
Gene Ontology Terms (51)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (219)
1 – 10 of 219
SYK
Tclin
Family: Kinase
Novelty: 0.00067612
Score: 0.988
Data Source: Reactome,STRINGDB
FCER1A
Tbio
Novelty: 0.0048976
Score: 0.984
Data Source: Reactome,STRINGDB
GP6
Tbio
Novelty: 0.00155083
Score: 0.976
Data Source: Reactome,STRINGDB
ITGB2
Tclin
Novelty: 0.00237551
Score: 0.973
Data Source: STRINGDB
PLCG2
Tchem
Family: Enzyme
Novelty: 0.00370802
Score: 0.973
Data Source: Reactome,STRINGDB
LYN
Tclin
Family: Kinase
Novelty: 0.00137519
Score: 0.973
Data Source: Reactome,STRINGDB
FCGR2B
Tbio
Novelty: 0.0014896
Score: 0.972
Data Source: STRINGDB
FCGR3A
Tbio
Novelty: 0.00059209
Score: 0.97
Data Source: STRINGDB
FCAR
Tbio
Novelty: 0.00567346
Score: 0.966
Data Source: STRINGDB
CLEC4E
Tchem
Novelty: 0.01046273
Score: 0.965
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  96.52

PubMed score by year
PubTator Score  117.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST
1-70
RNQETYETLKHEKPPQ
70-86
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ