You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PBLD
Phenazine biosynthesis-like domain-containing protein

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309049
  • ENSP00000308466
  • ENSG00000108187
  • ENST00000358769
  • ENSP00000351619
  • ENST00000495025
  • ENSP00000476306

Symbol
  • MAWBP
  • MAWBP
  • MAWDBP
  • HEL-S-306
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.8
transcription factor binding site profile
0.66
tissue sample
0.65
disease perturbation
0.62
histone modification site profile
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.39   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 221   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.39   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 221   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (12)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (26)
1 – 10 of 26
ZRANB1
Tbio
Family: Enzyme
Novelty: 0.10432689
p_int: 0.999999462
p_ni: 1.21e-7
p_wrong: 4.17e-7
Score: 0.54
Data Source: BioPlex,STRINGDB
MATN3
Tbio
Novelty: 0.00436449
p_int: 0.920409261
p_ni: 0.079590739
Score: 0.455
Data Source: BioPlex,STRINGDB
TRMT61A
Tbio
Family: Enzyme
Novelty: 0.06810443
p_int: 0.916384784
p_ni: 0.083615215
Score: 0.299
Data Source: BioPlex,STRINGDB
PLEKHS1
Tdark
Novelty: 0.92307692
p_int: 0.906823388
p_ni: 0.093176612
Score: 0.685
Data Source: BioPlex,STRINGDB
STRAP
Tbio
Family: Enzyme
Novelty: 0.03966134
Score: 0.952
Data Source: STRINGDB
MYPN
Tbio
Novelty: 0.04652292
Score: 0.724
Data Source: STRINGDB
RUFY2
Tbio
Novelty: 0.76564417
Score: 0.709
Data Source: STRINGDB
SLC25A16
Tbio
Family: Transporter
Novelty: 0.00123354
Score: 0.629
Data Source: STRINGDB
TMEM50A
Tdark
Novelty: 0.5
Score: 0.617
Data Source: STRINGDB
FRMPD2
Tbio
Novelty: 0.59102902
Score: 0.588
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.39

PubMed score by year
PubTator Score  8.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF
1-70
TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI
70-140
KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA
140-210
FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV
210-280
VLEGTLTA
280-288
MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWFTPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAVVLEGTLTA