You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
IL12A
Interleukin-12 subunit alpha

Protein Summary
Description
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000305579
  • ENSP00000303231
  • ENSG00000168811

Symbol
  • NKSF1
  • P35
  • CLMF
  • NFSK
  • NKSF1
  • IL-12A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
chemical
0.97
biological term
0.95
phenotype
0.83
virus perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.89   (req: < 5)
Gene RIFs: 228   (req: <= 3)
Antibodies: 834   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.89   (req: >= 5)
Gene RIFs: 228   (req: > 3)
Antibodies: 834   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 40
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
ustekinumab
no chemical structure image available
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (52)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-10 signaling
Reactome
Interleukin-12 family signaling
Reactome
Interleukin-12 signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-10 signaling
Interleukin-12 family signaling
Interleukin-12 signaling
Gene Ontology Terms (46)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
AgBase
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (96)
1 – 10 of 96
SPDL1
Tbio
Novelty: 0.02478116
p_int: 0.991637769
p_ni: 0.008362231
Score: 0.187
Data Source: BioPlex,STRINGDB
F11R
Tbio
Novelty: 0.00254252
p_int: 0.981391895
p_ni: 1.61e-7
p_wrong: 0.018607944
Score: 0.416
Data Source: BioPlex,STRINGDB
FSTL1
Tbio
Novelty: 0.00842838
p_int: 0.954127365
p_ni: 0.045871395
p_wrong: 0.00000124
Score: 0.163
Data Source: BioPlex,STRINGDB
COL14A1
Tbio
Novelty: 0.00758642
p_int: 0.95009592
p_ni: 0.04990408
Score: 0.165
Data Source: BioPlex,STRINGDB
RAB3B
Tbio
Family: Enzyme
Novelty: 0.03851756
p_int: 0.790561688
p_ni: 0.209289968
p_wrong: 0.000148343
Score: 0.21
Data Source: BioPlex,STRINGDB
IL12B
Tclin
Novelty: 0.01776322
Score: 0.996
Data Source: Reactome,STRINGDB
EBI3
Tbio
Novelty: 0.12504342
Score: 0.975
Data Source: Reactome,STRINGDB
IL10
Tbio
Novelty: 0.00007359
Score: 0.968
Data Source: STRINGDB
IL12RB2
Tbio
Novelty: 0.02915666
Score: 0.951
Data Source: Reactome,STRINGDB
STAT1
Tchem
Family: TF
Novelty: 0.00041067
Score: 0.951
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  10.89

PubMed score by year
PubTator Score  349.3

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEID
1-70
HEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKT
70-140
MNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTID
140-210
RVMSYLNAS
210-219
MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS