You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
EPHB2
Ephrin type-B receptor 2

Protein Summary
Description
Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Functions in axon guidance during development. Involved in the guidance of commissural axons, that form a major interhemispheric connection between the 2 temporal lobes of the cerebral cortex. Also involved in guidance of contralateral inner ear efferent growth cones at the midline and of retinal ganglion cell axons to the optic disk. In addition to axon guidance, also regulates dendritic spines development and maturation and stimulates the formation of excitatory synapses. Upon activation by EFNB1, abolishes the ARHGEF15-mediated negative regulation on excitatory synapse formation. Controls other aspects of developm ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374630
  • ENSP00000363761
  • ENSG00000133216
  • ENST00000374632
  • ENSP00000363763
  • ENST00000400191
  • ENSP00000383053

Symbol
  • DRT
  • EPHT3
  • EPTH3
  • ERK
  • HEK5
  • TYRO5
  • DRT
  • EK5
  • ERK
  • CAPB
  • Hek5
  • PCBC
  • EPHT3
  • Tyro5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
protein domain
1
molecular function
0.99
transcription factor perturbation
0.88
biological process
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 536.81   (req: < 5)
Gene RIFs: 74   (req: <= 3)
Antibodies: 611   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 536.81   (req: >= 5)
Gene RIFs: 74   (req: > 3)
Antibodies: 611   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 52
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 8
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (208)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
EPH-Ephrin signaling
Reactome
EPH-ephrin mediated repulsion of cells
Reactome
Ephrin signaling
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
EPH-Ephrin signaling
EPH-ephrin mediated repulsion of cells
Ephrin signaling
Gene Ontology Terms (67)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
ARUK-UCL
Inferred from Sequence or structural Similarity (ISS)
ARUK-UCL
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (245)
1 – 10 of 245
SPSB2
Tbio
Novelty: 0.07794377
p_int: 0.999999981
p_ni: 1.7e-8
p_wrong: 2e-9
Score: 0.557
Data Source: BioPlex,STRINGDB
EFNB2
Tbio
Novelty: 0.00309066
p_int: 0.999999861
p_ni: 5.9e-8
p_wrong: 8e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
MYCBP2
Tbio
Family: Enzyme
Novelty: 0.00336142
p_int: 0.999796533
p_ni: 0.000203468
Data Source: BioPlex
FBXO45
Tbio
Novelty: 0.08978487
p_int: 0.999685567
p_ni: 0.000305167
p_wrong: 0.000009266
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.90002893
p_ni: 0.09997107
Score: 0.157
Data Source: BioPlex,STRINGDB
EFNA5
Tbio
Novelty: 0.00173565
Score: 0.999
Data Source: STRINGDB
EFNB1
Tbio
Novelty: 0.00491089
Score: 0.997
Data Source: STRINGDB
EFNA1
Tbio
Family: Kinase
Novelty: 0.00738582
Score: 0.993
Data Source: STRINGDB
EFNA3
Tbio
Novelty: 0.01717372
Score: 0.993
Data Source: STRINGDB
EFNA2
Tbio
Novelty: 0.0109729
Score: 0.993
Data Source: STRINGDB
Publication Statistics
PubMed Score  536.81

PubMed score by year
PubTator Score  379.27

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQN
1-70
NWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDT
70-140
IAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQET
140-210
LSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKAN
210-280
QGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDS
280-350
GGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF
350-420
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPT
420-490
NTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVV
490-560
IAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAG
560-630
EFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITE
630-700
FMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRF
700-770
LEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
770-840
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIP
840-910
DYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQ
910-980
IQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKESND
980-1050
CSCGG
1050-1055
MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKESNDCSCGG