You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PCSK6
Proprotein convertase subtilisin/kexin type 6

Protein Classes
Protein Summary
Description
Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000611716
  • ENSP00000482760
  • ENSG00000140479
  • ENST00000611967
  • ENSP00000477768
  • ENST00000615296
  • ENSP00000478081
  • ENST00000618548
  • ENSP00000479496

Symbol
  • PACE4
  • SPC4
  • PACE4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
disease perturbation
0.87
transcription factor perturbation
0.84
PubMedID
0.8
cellular component
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 214.57   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 300   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 214.57   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 300   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 8
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Assembly of active LPL and LIPC lipase complexes (R-HSA-8963889)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Assembly of active LPL and LIPC lipase complexes
Reactome
Developmental Biology
Reactome
Expression and Processing of Neurotrophins
Reactome
Formation of the cornified envelope
Reactome
Keratinization
Name
Explore in Pharos
Explore in Source
Assembly of active LPL and LIPC lipase complexes
Developmental Biology
Expression and Processing of Neurotrophins
Formation of the cornified envelope
Keratinization
Protein-Protein Interactions (40)
1 – 10 of 40
TMEM25
Tdark
Novelty: 0.57954545
p_int: 0.760590849
p_ni: 0.239409151
Score: 0.243
Data Source: BioPlex,STRINGDB
NODAL
Tbio
Novelty: 0.01417238
Score: 0.942
Data Source: Reactome,STRINGDB
FLG
Tbio
Novelty: 0.0009107
Score: 0.936
Data Source: Reactome,STRINGDB
NGF
Tchem
Novelty: 0.00009278
Score: 0.915
Data Source: Reactome,STRINGDB
LPL
Tchem
Family: Enzyme
Novelty: 0.00074704
Score: 0.91
Data Source: Reactome,STRINGDB
GPIHBP1
Tbio
Novelty: 0.01411894
Score: 0.907
Data Source: Reactome,STRINGDB
KRT6B
Tbio
Novelty: 0.00713479
Score: 0.787
Data Source: STRINGDB
LRRTM1
Tbio
Novelty: 0.05800638
Score: 0.77
Data Source: STRINGDB
PCSK9
Tclin
Family: Enzyme
Novelty: 0.00047935
Score: 0.728
Data Source: STRINGDB
SCG5
Tbio
Novelty: 0.00425258
Score: 0.693
Data Source: STRINGDB
Publication Statistics
PubMed Score  214.57

PubMed score by year
PubTator Score  93.31

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPPRAPPAPGPRPPPRAAAATDTAAGAGGAGGAGGAGGPGFRPLAPRPWRWLLLLALPAACSAPPPRPVY
1-70
TNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQ
70-140
QEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIER
140-210
NHPDLAPNYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLD
210-280
GDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR
280-350
EGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTS
350-420
VSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEA
420-490
KKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYL
490-560
VSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILY
560-630
GTAEHPYHTFSAHQSRSRMLELSAPELEPPKAALSPSQVEVPEDEEDYTAQSTPGSANILQTSVCHPECG
630-700
DKGCDGPNADQCLNCVHFSLGSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSSRAATQCLSCRRG
700-770
FYHHQEMNTCVTLCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDS
770-840
ELIRCGECHHTCGTCVGPGREECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAG
840-910
SSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
910-969
MPPRAPPAPGPRPPPRAAAATDTAAGAGGAGGAGGAGGPGFRPLAPRPWRWLLLLALPAACSAPPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLELSAPELEPPKAALSPSQVEVPEDEEDYTAQSTPGSANILQTSVCHPECGDKGCDGPNADQCLNCVHFSLGSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSSRAATQCLSCRRGFYHHQEMNTCVTLCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDSELIRCGECHHTCGTCVGPGREECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG