You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HOXD10
Homeobox protein Hox-D10

Protein Summary
Description
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000249501
  • ENSP00000249501
  • ENSG00000128710

Symbol
  • HOX4D
  • HOX4E
  • HOX4
  • HOX4D
  • HOX4E
  • Hox-4.4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.77
gene perturbation
0.66
transcription factor perturbation
0.61
PubMedID
0.59
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 70.84   (req: < 5)
Gene RIFs: 27   (req: <= 3)
Antibodies: 280   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 70.84   (req: >= 5)
Gene RIFs: 27   (req: > 3)
Antibodies: 280   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (19)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (48)
1 – 10 of 48
SERPINB4
Tbio
Novelty: 0.00952994
p_int: 0.98843755
p_ni: 0.01156245
Score: 0.228
Data Source: BioPlex,STRINGDB
HOXD11
Tbio
Family: TF
Novelty: 0.02536341
Score: 0.83
Data Source: STRINGDB
RHOC
Tbio
Family: Enzyme
Novelty: 0.00407673
Score: 0.694
Data Source: STRINGDB
HOXD9
Tbio
Family: TF
Novelty: 0.02722706
Score: 0.635
Data Source: STRINGDB
PBX1
Tbio
Family: TF
Novelty: 0.00446947
Score: 0.632
Data Source: STRINGDB
MMP14
Tchem
Family: Enzyme
Novelty: 0.00092685
Score: 0.617
Data Source: STRINGDB
POLR3K
Tbio
Family: Enzyme
Novelty: 0.16129032
Score: 0.569
Data Source: STRINGDB
HOXD8
Tbio
Family: TF
Novelty: 0.07165016
Score: 0.562
Data Source: STRINGDB
HOXD13
Tbio
Family: TF
Novelty: 0.00497439
Score: 0.559
Data Source: STRINGDB
GMNN
Tbio
Novelty: 0.00563598
Score: 0.543
Data Source: STRINGDB
Publication Statistics
PubMed Score  70.84

PubMed score by year
PubTator Score  43.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN
1-70
VHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCP
70-140
VENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEP
140-210
TKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLE
210-280
LEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
280-340
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS