You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HOXD9
Homeobox protein Hox-D9

Protein Summary
Description
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000249499
  • ENSP00000249499
  • ENSG00000128709

Symbol
  • HOX4C
  • HOX4
  • HOX4C
  • Hox-4.3
  • Hox-5.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.88
protein domain
0.85
biological process
0.84
kinase perturbation
0.84
tissue sample
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.76   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 167   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.76   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 167   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (50)
1 – 10 of 50
HOXD4
Tbio
Family: TF
Novelty: 0.01929267
Score: 0.875
Data Source: STRINGDB
HOXC4
Tbio
Family: TF
Novelty: 0.0385065
Score: 0.816
Data Source: STRINGDB
HOXA5
Tbio
Family: TF
Novelty: 0.00768782
Score: 0.804
Data Source: STRINGDB
HOXC5
Tbio
Family: TF
Novelty: 0.07954294
Score: 0.803
Data Source: STRINGDB
HOXB6
Tbio
Family: TF
Novelty: 0.02428861
Score: 0.792
Data Source: STRINGDB
HOXB5
Tbio
Family: TF
Novelty: 0.01360604
Score: 0.79
Data Source: STRINGDB
HOXB4
Tbio
Family: TF
Novelty: 0.00683339
Score: 0.773
Data Source: STRINGDB
MEIS1
Tbio
Family: TF
Novelty: 0.00603843
Score: 0.766
Data Source: STRINGDB
PBX1
Tbio
Family: TF
Novelty: 0.00446947
Score: 0.751
Data Source: STRINGDB
HAND2
Tbio
Family: TF
Novelty: 0.00439742
Score: 0.743
Data Source: STRINGDB
Publication Statistics
PubMed Score  37.76

PubMed score by year
PubTator Score  30.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPAGVADGPAATAAEFASCSFAP
1-70
RSAVFSASWSAVPSQPPAAAAMSGLYHPYVPPPPLAASASEPGRYVRSWMEPLPGFPGGAGGGGGGGGGG
70-140
PGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCN
140-210
SFLQEKAAAATGGTGPGAGIGAATGTGGSSEPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPAANWI
210-280
HARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPK
280-350
GD
350-352
MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPAGVADGPAATAAEFASCSFAPRSAVFSASWSAVPSQPPAAAAMSGLYHPYVPPPPLAASASEPGRYVRSWMEPLPGFPGGAGGGGGGGGGGPGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAAATGGTGPGAGIGAATGTGGSSEPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPKGD