Protein Summary
Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity. [provi ...more
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 20.35 (req: < 5)
Gene RIFs: 7 (req: <= 3)
Antibodies: 121 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 20.35 (req: >= 5)
Gene RIFs: 7 (req: > 3)
Antibodies: 121 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Term: 1
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (59)
KEGG (1)
WikiPathways (58)
Items per page:
1 – 1 of 1
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
KEGG | Salivary secretion | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Salivary secretion | ||||
Gene Ontology Terms (4)
Functions (1)
Components (3)
Items per page:
10
1 – 1 of 1
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Protein-Protein Interactions (43)
1 – 10 of 43
FKBP15
Novelty: 0.07897873
p_int: 0.999999986
p_ni: 1.4e-8
Data Source: BioPlex
MCAM
Novelty: 0.00160429
p_int: 0.999996857
p_ni: 0.000003114
p_wrong: 2.9e-8
Data Source: BioPlex
SIRT2
Family: Epigenetic
Novelty: 0.00117896
p_int: 0.999988597
p_ni: 0.000011403
Data Source: BioPlex
CTSH
Family: Enzyme
Novelty: 0.00380318
p_int: 0.999956686
p_ni: 0.000043314
Score: 0.473
Data Source: BioPlex,STRINGDB
ENDOG
Family: Enzyme
Novelty: 0.00557198
p_int: 0.999954876
p_ni: 0.000040628
p_wrong: 0.000004495
Data Source: BioPlex
TENM3
Novelty: 0.0087482
p_int: 0.999893159
p_ni: 0.000106841
Data Source: BioPlex
BCHE
Family: Enzyme
Novelty: 0.00041933
p_int: 0.997833732
p_ni: 0.002165422
p_wrong: 8.46e-7
Data Source: BioPlex
RCAN1
Novelty: 0.00396344
p_int: 0.994114291
p_ni: 0.000103941
p_wrong: 0.005781768
Score: 0.19
Data Source: BioPlex,STRINGDB
KIR2DS2
p_int: 0.994052807
p_ni: 0.000075622
p_wrong: 0.005871572
Data Source: BioPlex
SNRPF
Novelty: 0.22699635
p_int: 0.990892694
p_ni: 0.000069337
p_wrong: 0.009037969
Data Source: BioPlex
Publication Statistics
PubMed Score 20.35
PubMed score by year
PubTator Score 19.38
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQ
1-70
VMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCR
70-140
KV
140-142
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Find similar targets by: