You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FKBP2
Peptidyl-prolyl cis-trans isomerase FKBP2

Protein Summary
Description
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309366
  • ENSP00000310935
  • ENSG00000173486
  • ENST00000394540
  • ENSP00000378046
  • ENST00000449942
  • ENSP00000398147

Symbol
  • FKBP13
  • PPIase
  • FKBP-13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
transcription factor
0.84
transcription factor binding site profile
0.75
virus perturbation
0.72
cell type or tissue
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 80.57   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 127   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 80.57   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 127   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (112)
1 – 10 of 112
PPIB
Tchem
Family: Enzyme
Novelty: 0.00490532
Score: 0.951
Data Source: STRINGDB
TAGLN
Tbio
Novelty: 0.00228885
Score: 0.88
Data Source: STRINGDB
FKBP1A
Tclin
Family: Enzyme
Novelty: 0.00153087
Score: 0.844
Data Source: STRINGDB
PIN1
Tchem
Family: Enzyme
Novelty: 0.00170157
Score: 0.818
Data Source: STRINGDB
MAP3K11
Tchem
Family: Kinase
Novelty: 0.01297827
Score: 0.794
Data Source: STRINGDB
COX8A
Tbio
Family: Enzyme
Novelty: 0.00619913
Score: 0.788
Data Source: STRINGDB
FAU
Tbio
Novelty: 0.00623352
Score: 0.769
Data Source: STRINGDB
FOSL1
Tbio
Family: TF
Novelty: 0.00369713
Score: 0.769
Data Source: STRINGDB
FAU
Tbio
Novelty: 0.00623352
Score: 0.769
Data Source: STRINGDB
SF1
Tbio
Novelty: 0.02147421
Score: 0.765
Data Source: STRINGDB
Publication Statistics
PubMed Score  80.57

PubMed score by year
PubTator Score  25.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL
1-70
PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT
70-140
EL
140-142
MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL