You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KLRC1
NKG2-A/NKG2-B type II integral membrane protein

Protein Summary
Description
Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been obse ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000347831
  • ENSP00000256965
  • ENSG00000134545
  • ENST00000359151
  • ENSP00000352064
  • ENST00000408006
  • ENSP00000385304
  • ENST00000544822
  • ENSP00000438038

Symbol
  • NKG2A
  • NKG2
  • NKG2A
  • CD159A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.71
cell line
0.61
PubMedID
0.6
molecular function
0.53
biological term
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.99   (req: < 5)
Gene RIFs: 53   (req: <= 3)
Antibodies: 561   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.99   (req: >= 5)
Gene RIFs: 53   (req: > 3)
Antibodies: 561   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Protein-Protein Interactions (165)
1 – 10 of 165
HLA-E
Tbio
Novelty: 0.00263667
Score: 0.999
Data Source: Reactome,STRINGDB
B2M
Tbio
Novelty: 0.00012184
Score: 0.992
Data Source: Reactome,STRINGDB
PTPN6
Tchem
Family: Enzyme
Novelty: 0.00619412
Score: 0.991
Data Source: STRINGDB
KLRD1
Tbio
Novelty: 0.00257574
Score: 0.989
Data Source: Reactome,STRINGDB
KIR2DL1
Tbio
Novelty: 0.00334448
Score: 0.972
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.968
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.968
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.968
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.968
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score  270.99

PubMed score by year
PubTator Score  406.23

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK
1-70
LIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTW
70-140
EESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAV
140-210
LQVNRLKSAQCGSSIIYHCKHKL
210-233
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL