You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LMO2
Rhombotin-2

Protein Summary
Description
Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000257818
  • ENSP00000257818
  • ENSG00000135363
  • ENST00000395833
  • ENSP00000379175
  • ENST00000411482
  • ENSP00000401967

Symbol
  • RBTN2
  • RBTNL1
  • RHOM2
  • TTG2
  • TTG2
  • LMO-2
  • RBTN2
  • RHOM2
  • RBTNL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.99
virus perturbation
0.99
molecular function
0.98
kinase perturbation
0.96
disease perturbation
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 212   (req: < 5)
Gene RIFs: 75   (req: <= 3)
Antibodies: 682   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 212   (req: >= 5)
Gene RIFs: 75   (req: > 3)
Antibodies: 682   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
RUNX1 regulates transcription of genes involved in differentiation of HSCs
Reactome
Transcriptional regulation by RUNX1
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
RUNX1 regulates transcription of genes involved in differentiation of HSCs
Transcriptional regulation by RUNX1
Gene Ontology Terms (15)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (182)
1 – 10 of 182
GORAB
Tbio
Novelty: 0.05020497
p_int: 0.999999986
p_wrong: 1.4e-8
Score: 0.182
Data Source: BioPlex,STRINGDB
RECQL5
Tbio
Family: Enzyme
Novelty: 0.01938916
p_int: 0.999999948
p_ni: 5.1e-8
p_wrong: 1e-9
Score: 0.618
Data Source: BioPlex,STRINGDB
MEX3D
Tdark
Novelty: 0.02473644
p_int: 0.999999878
p_ni: 1.21e-7
p_wrong: 1e-9
Score: 0.181
Data Source: BioPlex,STRINGDB
LDB1
Tbio
Novelty: 0.00548345
p_int: 0.999999701
p_ni: 2.95e-7
p_wrong: 4e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
MN1
Tbio
Novelty: 0.00146056
p_int: 0.999999518
p_ni: 5.1e-8
p_wrong: 4.31e-7
Score: 0.44
Data Source: BioPlex,STRINGDB
RNF31
Tbio
Family: Enzyme
Novelty: 0.01498949
p_int: 0.999998951
p_ni: 0.000001049
Data Source: BioPlex
RBCK1
Tbio
Novelty: 0.02344672
p_int: 0.999997922
p_ni: 0.000002078
Data Source: BioPlex
RPAP2
Tbio
Family: Enzyme
Novelty: 0.07575758
p_int: 0.999994677
p_ni: 0.000005323
Score: 0.519
Data Source: BioPlex,STRINGDB
SSBP3
Tbio
Novelty: 0.02698795
p_int: 0.999993645
p_ni: 0.000006355
Score: 0.742
Data Source: BioPlex,STRINGDB
SSBP2
Tbio
Novelty: 0.07797045
p_int: 0.999993429
p_ni: 0.00000657
p_wrong: 2e-9
Score: 0.77
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  212.00

PubMed score by year
PubTator Score  174.66

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR
1-70
LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS
70-140
DIVCEQDIYEWTKINGMI
140-158
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI